RIDINRIEKEEDIKLLKELKWNGFVFYQYDDEFSKDRYEEVKAIAESYKLKVYSGVKIKTESSKQLRDKVKKFRNKCHII
LIEGGVLKINRAAVELHDVDILSTPELGRKDSGIDHVLARLASNHRVAIELNFKTLLNKDGYERARTLLFFRNNLKLAKK
FDVPVVISTDAENKYQIKNPYDLRAFLNTLVEPLYAKKIMETAYKICDFRDYLMRDNVVRYGVEII
The query sequence (length=226) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6k0b:C | 231 | 226 | 1.0000 | 0.9784 | 1.0000 | 1.27e-165 | 6k0a:D, 6k0b:D |
2 | 5ltm:B | 537 | 89 | 0.1150 | 0.0484 | 0.2921 | 1.3 | 5ltm:A |
3 | 3guw:A | 233 | 24 | 0.0487 | 0.0472 | 0.4583 | 6.3 | 3guw:B, 3guw:C, 3guw:D |
4 | 8bot:A | 3528 | 43 | 0.0664 | 0.0043 | 0.3488 | 6.6 |