RIAGFRFSLYPMTDDFISVIKSALAATDTSKVWTKTDHISTVLRGSIDHVFDAAKAIYLHAANSEQHIVMNGTFSIGCPG
DTQGDTYLDKRVNEDAVRGLKAEAPCQFALYPMNEPDYMGLIMEAVDIAKAQGTFVQGVHYASELDGDAHDVFSTLEAVF
RMAEQQTNHITMTVNLSANSPSRKNR
The query sequence (length=186) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1s99:A | 186 | 186 | 1.0000 | 1.0000 | 1.0000 | 2.25e-141 | 1sbr:A, 1sbr:B |
2 | 5ol2:B | 260 | 39 | 0.0914 | 0.0654 | 0.4359 | 0.28 | 5ol2:E |
3 | 6szg:A | 222 | 103 | 0.1559 | 0.1306 | 0.2816 | 1.4 | 6szg:B, 6szh:B |
4 | 8xxw:A | 561 | 94 | 0.1183 | 0.0392 | 0.2340 | 5.8 | |
5 | 8hku:ARF1 | 232 | 67 | 0.1290 | 0.1034 | 0.3582 | 6.8 | |
6 | 5hn4:A | 329 | 24 | 0.0699 | 0.0395 | 0.5417 | 8.0 | 5hn6:A |