RHVFIRTELSFIKNNVPCIRDMFFIYKRELYNICLDDLETHIYVQKKVKDSWITLNDLFKETDLTGRPHIFAYVDVEEII
ILLCEDEEFSNRKKDMTCHRFYSNDGKEYNNAEITISDYILKDKLLSSYVSLPLKIENREYFLICGVSPDDILCMASHDK
GETWGTKIVIKYDNYKLGVQYFFLRPYISKNDLSFHFYVGDNIVKNVNFIECTHEKDLEFVCSNRDFLKDNKVLQDVSTL
NDEYIVSYGNDNNFAECYIFFNNENSILIKPEKYGGCYGGTFVKIDENRALFIYSSSQGIYNIHTIYYANYE
The query sequence (length=312) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7pi3:H | 321 | 322 | 0.9936 | 0.9657 | 0.9627 | 0.0 | 6mpv:A, 7phw:A, 7phw:D |
2 | 2ber:A | 601 | 77 | 0.0673 | 0.0349 | 0.2727 | 2.2 | 2bzd:A, 2bzd:B, 2bzd:C, 1eus:A, 1euu:A, 1w8n:A, 1w8o:A, 1wcq:A, 1wcq:B, 1wcq:C |
3 | 4fbk:A | 424 | 78 | 0.0673 | 0.0495 | 0.2692 | 3.3 | 4fbk:B, 4fbq:A, 4fbq:B, 4fbw:A, 4fbw:B |
4 | 5ktc:A | 187 | 63 | 0.0641 | 0.1070 | 0.3175 | 4.5 | 5ktd:A |
5 | 4jdz:B | 445 | 139 | 0.0994 | 0.0697 | 0.2230 | 6.7 | 4jdz:A, 4je0:A |
6 | 3v97:A | 667 | 77 | 0.0609 | 0.0285 | 0.2468 | 9.1 | 3v8v:A |
7 | 5dzc:A | 816 | 40 | 0.0385 | 0.0147 | 0.3000 | 9.5 | 8em8:A, 5ezr:A, 5f0a:A, 5fet:A, 4ofg:A, 4rz7:A |