RGPRKGGRVIAPKKARVVQQQKLKKNLEVGIRKKIEHDVVMKASS
The query sequence (length=45) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8fla:VB | 58 | 44 | 0.9778 | 0.7586 | 1.0000 | 8.12e-25 | 8flb:VB, 8flc:VB, 8idt:T, 8idy:T, 8ine:T, 8inf:T |
2 | 8jun:A | 678 | 39 | 0.3111 | 0.0206 | 0.3590 | 3.5 | 8jun:B |
3 | 3egd:B | 731 | 25 | 0.2444 | 0.0150 | 0.4400 | 3.6 | 3egx:B, 8hr0:B, 2nup:B, 2nut:B, 5vne:B, 5vnf:B, 5vng:B, 5vnh:B, 5vni:B, 5vnj:B, 5vnk:B, 5vnl:B, 5vnm:B, 5vnn:B, 5vno:B |
4 | 3j79:I | 207 | 24 | 0.3111 | 0.0676 | 0.5833 | 4.2 | 3jbn:AI, 3jbo:AI, 3jbp:AI, 8tpu:AI, 5umd:I |
5 | 5xut:A | 1217 | 23 | 0.2222 | 0.0082 | 0.4348 | 4.6 | 5id6:A, 6nm9:B, 6nm9:D, 6nma:B, 6nmc:A, 6nmd:A, 6nme:A, 6omv:B, 5xus:A, 5xuu:A, 5xuz:A, 5xuz:E |
6 | 6kl9:A | 1180 | 23 | 0.2222 | 0.0085 | 0.4348 | 4.8 | |
7 | 6klb:A | 1118 | 23 | 0.2222 | 0.0089 | 0.4348 | 5.3 | 6klb:D |
8 | 8woq:A | 647 | 39 | 0.3333 | 0.0232 | 0.3846 | 5.6 | 8j6m:B, 8j6m:A, 8jul:A, 8jul:B, 8kcw:A, 8kcw:C, 8woq:B, 8wor:A, 8wor:B, 8wos:A, 8wos:B, 8wot:A, 8wot:B |
9 | 4pfy:A | 539 | 27 | 0.2444 | 0.0204 | 0.4074 | 6.1 | 4pft:A, 4pft:B, 4pfy:B |