BioLiP

>protein
RGDDGTTGLSDMSRVAKTDARLVAYADCDEANAAIGAALALGHPDTQITDVLRQIQNDLFDAGADLSTPIVENPKHPPLR
IAQSYIDRLEGWCDAYNAGLPALKSFVLPGGSPLSALLHVARTVVRRAERSAWAAVDAHPEGVSVLPAKYLNRLSDLLFI
LSRVANPDGDVLWRPGG

The query sequence (length=177) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8d32:A	186	176	0.9944	0.9462	1.0000	5.78e-127	6wgs:A, 6wgv:A, 6wh5:A, 6wh5:B, 6wh5:C
2	2zhz:B	174	175	0.4859	0.4943	0.4914	4.01e-42	2zhz:A, 2zhz:C
3	3ke5:A	182	168	0.4124	0.4011	0.4345	1.32e-31	3ke5:C, 3ke5:B
4	3ci1:A	188	177	0.3729	0.3511	0.3729	5.82e-29	3ci3:A, 3ci4:A, 3gah:A, 3gai:A, 3gaj:A, 2nt8:A, 2r6t:A, 2r6t:B, 2r6x:A, 2r6x:B
5	7rut:E	187	168	0.3559	0.3369	0.3750	5.63e-22	6d5k:A, 6d5k:C, 6d5k:B, 6d5x:A, 6d5x:C, 6d5x:B, 2idx:A, 2idx:C, 2idx:B, 7rut:D, 7rut:C, 7rut:F, 7rut:B, 7rut:A, 7ruu:A, 7ruu:C, 7ruu:B, 7ruu:D, 7ruv:A, 7ruv:D, 7ruv:B, 7ruv:C
6	1cen:A	334	99	0.1525	0.0808	0.2727	1.7
7	8qog:B	500	48	0.0847	0.0300	0.3125	3.9	8iaj:A, 8iaj:E, 8iak:A, 8iak:E, 8qof:F, 8qof:B
8	3g4f:A	515	91	0.1243	0.0427	0.2418	5.1	3g4f:B
9	5uzx:A	231	30	0.0621	0.0476	0.3667	6.0	5uzx:B
10	8x6f:D	1176	64	0.1243	0.0187	0.3438	6.5	8x6g:D
11	4qbj:A	396	80	0.1130	0.0505	0.2500	6.6	4cav:A, 4caw:A, 4cax:A, 5t5u:A, 5t6c:A, 5t6e:A, 5t6h:A, 4uwi:A, 4uwj:A
12	8sod:A	941	16	0.0621	0.0117	0.6875	8.5	8soe:A

[Back]