RFRVYSKYLFLTYPQCTLEPQYALDSLRTLLNKYEPLYIAAVRELHSPHLHVLVQNKLRASITNPNALNLRMDTSPFSIF
HPNIQAAKDCNQVRDFITKEVSDVNTAEWGTFVAVS
The query sequence (length=116) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6we0:A | 119 | 119 | 0.9914 | 0.9664 | 0.9664 | 2.87e-80 | 6we1:A, 6we1:D |
2 | 7kik:A | 121 | 77 | 0.6379 | 0.6116 | 0.9610 | 9.61e-48 | |
3 | 7kik:A | 121 | 43 | 0.3621 | 0.3471 | 0.9767 | 6.31e-24 | |
4 | 7vg8:A | 108 | 114 | 0.3793 | 0.4074 | 0.3860 | 9.76e-19 | |
5 | 8wai:A | 277 | 33 | 0.1121 | 0.0469 | 0.3939 | 0.41 | 8kce:A, 8wai:B |
6 | 2v40:A | 419 | 81 | 0.1724 | 0.0477 | 0.2469 | 2.6 | |
7 | 4ax8:A | 450 | 33 | 0.1207 | 0.0311 | 0.4242 | 7.4 | 4azs:A, 4azt:A, 4azv:A |
8 | 4uw0:A | 501 | 33 | 0.1207 | 0.0279 | 0.4242 | 7.4 | 4azw:A |
9 | 6y1w:A | 505 | 53 | 0.1207 | 0.0277 | 0.2642 | 8.1 | 6y1w:B |