RFILEISGDLACFTRSELKVERVSYPVITPAAARNILMAILWKPAIRWKVLKIEILKPIQWTNIRRNEVGTKMSERSGSL
YIEDNRQQRASMLLKDVAYRIHADFDMTSEAGESDNYVKFAEMFKRRAKKGQYFHQPYLGCREFPCDFRLLEKAEDGLPL
EDITQDFGFMLYDMDFSKSDPRDSNNAEPMFYQCKAVNGVITVPP
The query sequence (length=205) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8g9s:N | 205 | 205 | 1.0000 | 1.0000 | 1.0000 | 4.98e-156 | 8g9t:N, 8g9u:N, 8gaf:N, 8gam:N, 8gan:N |
2 | 8dej:A | 220 | 216 | 0.4829 | 0.4500 | 0.4583 | 7.52e-58 | 8dex:A, 8dfa:A, 8dfo:A, 8dfs:A, 7kha:A |
3 | 9exw:A | 148 | 64 | 0.0829 | 0.1149 | 0.2656 | 2.1 | 9exw:B, 9exx:A, 9exx:B, 9exy:A, 7lmt:A, 7lmt:H, 7lmt:B, 7lmt:C, 7lmt:D, 7lmt:E, 7lmt:F, 7lmt:G, 7mdn:A, 7mdn:H, 7mdn:B, 7mdn:C, 7mdn:D, 7mdn:E, 7mdn:F, 7mdn:G, 6ue6:A, 6ue6:B, 6ue6:D, 6ue6:E, 6ue6:G, 6ue6:H, 5vc8:A, 7vln:B, 6xcg:A, 6xcg:B, 6xcg:C |
4 | 8jg4:B | 154 | 57 | 0.0780 | 0.1039 | 0.2807 | 3.7 | 8jg4:A |