RFDATPPAGEPDRPALGVLELTSIARGITVADAALKRAPSLLLMSRPVCSGKHLLMMRGQVAEVEESMIAAREIAGAGSG
ALLDELELPYAHEQLWRFLDAPVVADAWESVIIVETATVCAAIDSADAALKTAPVVLRDMRLAIGIAGKAFFTLTGELAD
VEAAAEVVRERCGARLLELACIARPVDELRGRLFF
The query sequence (length=195) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5dii:C | 199 | 195 | 0.9897 | 0.9698 | 0.9897 | 3.49e-133 | 5dii:A, 5dii:B, 5dii:D, 5dii:E, 5dii:F |
| 2 | 2wnr:B | 222 | 66 | 0.1179 | 0.1036 | 0.3485 | 1.2 | 2wnr:D, 2wnr:F |
| 3 | 3t6a:B | 308 | 61 | 0.1026 | 0.0649 | 0.3279 | 2.0 | 3t6a:D |
| 4 | 7qhm:U | 154 | 43 | 0.0667 | 0.0844 | 0.3023 | 5.1 | 7q21:L, 7q21:l, 7qhm:H, 7qho:H, 7qho:U |
umich.edu