REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRS
DVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQP
NRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWS
LLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLML
TLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPV
The query sequence (length=358) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2agw:B | 361 | 358 | 1.0000 | 0.9917 | 1.0000 | 0.0 | 2agw:A, 2agx:B, 2agx:A, 2agy:B, 2agz:B, 2agz:A, 2ah0:B, 2ah0:A, 2hj4:B, 2hj4:A, 2hjb:B, 2hjb:A, 2hkr:B, 2hkr:A, 2iuq:A, 2iuq:B, 2oiz:A, 2ojy:A, 2q7q:B, 2q7q:A |
2 | 2ovq:B | 444 | 133 | 0.0922 | 0.0743 | 0.2481 | 0.35 | 2ovr:B, 7t1y:B, 7t1z:B, 5v4b:B |
3 | 3rhh:D | 480 | 73 | 0.0615 | 0.0458 | 0.3014 | 0.65 | 3rhh:A, 3rhh:B, 3rhh:C |
4 | 3a31:A | 465 | 152 | 0.1006 | 0.0774 | 0.2368 | 1.6 | 3a32:A |
5 | 2q3o:B | 367 | 87 | 0.0587 | 0.0572 | 0.2414 | 2.0 | 2g5w:A, 2g5w:B, 2q3o:A, 1q45:A, 1q45:B |
6 | 2wb9:A | 210 | 43 | 0.0475 | 0.0810 | 0.3953 | 2.0 | 2wb9:B, 2wdu:A, 2wdu:B |
7 | 6wnx:A | 410 | 53 | 0.0419 | 0.0366 | 0.2830 | 4.5 | 6m90:A, 6m91:A, 6m92:A, 6m93:A, 6m94:A, 1p22:A, 6ttu:T, 6wnx:D, 6wnx:G |
8 | 8c01:o | 314 | 117 | 0.0726 | 0.0828 | 0.2222 | 5.0 | |
9 | 6rxu:CW | 382 | 51 | 0.0419 | 0.0393 | 0.2941 | 5.8 | 6rxv:CW, 6rxx:CW, 6rxz:CW |
10 | 7aoe:A | 1401 | 70 | 0.0531 | 0.0136 | 0.2714 | 6.6 | 7aoc:A, 7aod:A, 7aod:M |
11 | 4d5e:B | 587 | 151 | 0.1034 | 0.0630 | 0.2450 | 10.0 | 4d5e:A, 4d5g:A, 4d5g:B, 2pgn:A, 2pgn:B, 2pgo:A, 2pgo:B |