RELKPQTCTICETTPVNAIDAEMHDLNCSYNICPYCASRLTSDGLARHVTQCPKRKEKVEETELYLNLERIPWVVRK
The query sequence (length=77) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2l7x:A | 77 | 77 | 1.0000 | 1.0000 | 1.0000 | 1.14e-53 | |
2 | 8w2o:B | 178 | 38 | 0.1818 | 0.0787 | 0.3684 | 1.7 | |
3 | 1e4u:A | 78 | 69 | 0.2727 | 0.2692 | 0.3043 | 2.0 | 1ur6:B |
4 | 3cvg:A | 270 | 27 | 0.1039 | 0.0296 | 0.2963 | 3.7 | 3cvg:B, 3cvg:C, 3cvg:D |
5 | 8fgw:C | 1342 | 61 | 0.1818 | 0.0104 | 0.2295 | 5.0 | 8fh3:C |
6 | 1wjp:A | 107 | 51 | 0.1818 | 0.1308 | 0.2745 | 5.8 | |
7 | 2vrd:A | 61 | 33 | 0.1558 | 0.1967 | 0.3636 | 6.5 | 4pjo:L, 4pjo:l, 4pjo:M, 4pjo:m, 6qx9:1C, 7vpx:N |
8 | 2w8h:A | 322 | 36 | 0.1688 | 0.0404 | 0.3611 | 6.9 | 2w8h:B, 2w8h:C, 2w8h:D, 2w8h:E, 2w8h:F, 2w8h:G, 2w8h:H |
9 | 4orh:H | 142 | 46 | 0.1688 | 0.0915 | 0.2826 | 8.4 | 4ayc:A, 4ayc:B, 4orh:C, 4orh:G, 4orh:K, 4orh:L, 4whv:C, 4whv:D, 4whv:I, 4whv:J |