RDFEYNNQDVNQLNGAFISLVEDEKIGFWVGVGGFAYSQFIMRKFVKSTNIFASVTSLFAGAALANLYTHQSRASYARVA
ARANRNASLALNKLMEY
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8gzu:0H | 97 | 97 | 1.0000 | 1.0000 | 1.0000 | 2.36e-67 | 8gzu:52, 8gzu:z1, 8gzu:Z1 |
2 | 1b0b:A | 142 | 45 | 0.1443 | 0.0986 | 0.3111 | 5.4 | 1ebt:A, 1flp:A, 1moh:A |
3 | 6ei3:A | 511 | 33 | 0.1237 | 0.0235 | 0.3636 | 7.8 | |
4 | 1f12:A | 293 | 32 | 0.1340 | 0.0444 | 0.4062 | 8.6 | 1f0y:A, 1f0y:B, 1f17:A, 1f17:B, 3had:A, 3had:B, 2hdh:A, 2hdh:B, 3hdh:A, 3hdh:B, 3hdh:C, 1il0:A, 1il0:B, 1lsj:A, 1lsj:B, 1lso:A, 1lso:B, 1m75:A, 1m75:B, 1m76:A, 1m76:B |