RCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGG
PCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCG
AGCQSGGCDG
The query sequence (length=170) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4aml:A | 171 | 170 | 0.9529 | 0.9474 | 0.9529 | 2.76e-106 | 4aml:B, 2cwg:B, 2cwg:A, 1wgc:A, 1wgc:B, 2wgc:B, 2x3t:A, 2x3t:B, 2x3t:C, 2x3t:D, 2x52:A, 2x52:B |
2 | 6sto:A | 165 | 168 | 0.6647 | 0.6848 | 0.6726 | 2.71e-64 | 6sto:B, 6stp:A, 6stp:B |
3 | 6sto:A | 165 | 126 | 0.4176 | 0.4303 | 0.5635 | 5.73e-36 | 6sto:B, 6stp:A, 6stp:B |
4 | 1uha:A | 82 | 79 | 0.2471 | 0.5122 | 0.5316 | 9.20e-18 | |
5 | 1uha:A | 82 | 78 | 0.2294 | 0.4756 | 0.5000 | 1.45e-16 | |
6 | 1uha:A | 82 | 36 | 0.1000 | 0.2073 | 0.4722 | 8.66e-04 | |
7 | 4wp4:A | 43 | 31 | 0.1353 | 0.5349 | 0.7419 | 3.12e-09 | |
8 | 4wp4:A | 43 | 33 | 0.1235 | 0.4884 | 0.6364 | 1.93e-06 | |
9 | 4wp4:A | 43 | 31 | 0.1059 | 0.4186 | 0.5806 | 3.06e-05 | |
10 | 4wp4:A | 43 | 40 | 0.1176 | 0.4651 | 0.5000 | 1.82e-04 | |
11 | 6lnr:A | 292 | 25 | 0.0882 | 0.0514 | 0.6000 | 1.1 | |
12 | 6lnr:A | 292 | 27 | 0.0882 | 0.0514 | 0.5556 | 4.0 | |
13 | 6lnr:A | 292 | 25 | 0.0824 | 0.0479 | 0.5600 | 8.2 |