BioLiP

>protein
RATRLKRMSEYAAKRLSSETREQRAIRLARMSAYAARRLANETPAQRQARLLRMSAYAAKRQAS

The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5d2s:A	91	63	0.9844	0.6923	1.0000	1.55e-35	5d23:A, 5d2q:A
2	5d2s:A	91	64	0.6406	0.4505	0.6406	3.89e-17	5d23:A, 5d2q:A
3	5d2s:A	91	46	0.5156	0.3626	0.7174	1.50e-13	5d23:A, 5d2q:A
4	3duf:A	365	42	0.2344	0.0411	0.3571	0.70	3duf:C, 3duf:E, 3duf:G, 3dv0:A, 3dv0:C, 3dv0:G, 3dva:A, 3dva:C, 3dva:E, 3dva:G, 1w85:A, 1w85:C, 1w85:E, 1w85:G
5	3dv0:E	344	42	0.2344	0.0436	0.3571	0.75	1w88:A, 1w88:C, 1w88:E, 1w88:G
6	5faw:B	806	37	0.2656	0.0211	0.4595	2.5	5fau:A, 5fau:B, 5fau:C, 5fau:D, 5faw:A, 5fay:A, 5fay:B, 6nd3:A, 6nd3:B, 6nd3:C, 6nd3:D, 6nd3:E, 6nd3:F, 6nd3:G, 6nd3:H, 6vue:A, 6vue:B
7	5hxx:A	424	37	0.2031	0.0307	0.3514	2.8	5hxx:B, 5iwq:A, 5iwq:B, 3ppl:A, 3ppl:B
8	8hpc:C	303	24	0.2031	0.0429	0.5417	4.2	8hpc:A, 8hpc:B, 8hpc:D, 8hpc:E, 8hpc:F, 8hpc:G, 8hpc:H, 1uf5:A, 1uf5:B, 1uf7:A, 1uf7:B, 1uf8:A, 1uf8:B
9	3t6d:C	334	45	0.2500	0.0479	0.3556	5.1	4ac5:C, 4cas:A, 3d38:C, 1dxr:C, 6et5:C, 3g7f:C, 2i5n:C, 2jbl:C, 5m7j:A, 5m7k:A, 5m7l:A, 5nj4:C, 5o4c:C, 5o64:C, 1prc:C, 2prc:C, 3prc:C, 5prc:C, 6prc:C, 7prc:C, 7q7p:CCC, 7q7q:CCC, 1r2c:C, 3t6e:C, 1vrn:C, 2wjm:C, 2wjn:C, 2x5u:C, 2x5v:C, 6zhw:C, 6zi4:C, 6zi5:C, 6zi6:C, 6zi9:C, 6zia:C, 6zid:C

[Back]