RARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCV
The query sequence (length=328) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
7tys:A |
361 |
328 |
0.9726 |
0.8837 |
0.9726 |
0.0 |
6baa:A, 6baa:D, 6baa:B, 6baa:C, 6c3o:A, 6c3o:B, 6c3o:C, 6c3o:D, 6c3p:A, 6c3p:B, 6c3p:D, 6c3p:C, 6jb1:A, 6jb1:G, 6jb1:C, 6jb1:E, 8ti1:D, 8ti1:A, 8ti1:B, 8ti1:C, 8ti2:D, 8ti2:A, 8ti2:B, 8ti2:C, 5twv:A, 5twv:C, 5twv:E, 5twv:G, 7tys:D, 7tys:B, 7tys:C, 7tyt:A, 7tyt:D, 7tyt:B, 7tyt:C, 7u1e:B, 7u1e:C, 7u1e:D, 7u1e:A, 7u1q:A, 7u1q:B, 7u1q:C, 7u1q:D, 7u1s:A, 7u1s:D, 7u1s:B, 7u1s:C, 7u24:A, 7u24:D, 7u24:B, 7u24:C, 7u6y:A, 7u6y:B, 7u6y:C, 7u6y:D, 7uaa:B, 7uaa:C, 7uaa:D, 7w4p:A, 7w4p:C, 7w4p:E, 7w4p:G, 5ykf:A, 5ykf:C, 5ykf:E, 5ykf:G, 5ykg:A, 5ykg:C, 5ykg:E, 5ykg:G, 5yw8:C, 5yw8:E, 5yw8:G, 5yw8:A, 5yw9:C, 5yw9:E, 5yw9:G, 5yw9:A, 5ywa:A, 5ywa:C, 5ywa:E, 5ywa:G, 5ywb:A, 5ywb:C, 5ywb:E, 5ywb:G, 5ywc:A, 5ywc:C, 5ywc:E, 5ywc:G |
2 |
7mjp:A |
366 |
334 |
0.7500 |
0.6721 |
0.7365 |
0.0 |
7mit:A, 7mit:B, 7mit:C, 7mit:D, 7mjo:A, 7mjo:B, 7mjo:C, 7mjo:D, 7mjp:B, 7mjp:D, 7mjq:A, 7mjq:B, 7mjq:C |
3 |
4kfm:A |
328 |
319 |
0.4878 |
0.4878 |
0.5016 |
2.43e-121 |
3auw:B, 3auw:D, 3sya:A, 3syo:A, 6xeu:A, 6xeu:D, 6xeu:G, 6xeu:J, 6xev:A, 6xev:E, 6xev:I, 6xev:M, 6xit:A, 6xit:B, 6xit:C, 6xit:D |
4 |
3spg:A |
332 |
329 |
0.5091 |
0.5030 |
0.5076 |
5.45e-117 |
5kuk:A, 5kum:A, 6m84:A, 3spc:A, 3sph:A, 3spi:A |
5 |
3syq:A |
292 |
318 |
0.4482 |
0.5034 |
0.4623 |
2.42e-103 |
|
6 |
8i5m:A |
310 |
315 |
0.3963 |
0.4194 |
0.4127 |
6.89e-87 |
8i5m:B, 8i5m:C, 8i5m:D, 8i5n:A, 8i5n:B, 8i5n:C, 8i5n:D |
7 |
2wll:B |
266 |
280 |
0.2317 |
0.2857 |
0.2714 |
7.31e-26 |
|
8 |
2x6b:A |
287 |
304 |
0.2622 |
0.2997 |
0.2829 |
4.65e-25 |
7n9k:A, 7n9l:A, 6o9t:A, 6o9u:A, 6o9v:A, 6o9v:B, 2x6a:A, 2x6c:A |
9 |
7e8e:D |
459 |
150 |
0.1006 |
0.0719 |
0.2200 |
2.7 |
7e87:B, 7e87:A, 7e87:C, 7e87:D, 7e8e:B, 1nn7:A, 7ukg:A, 7ukg:B, 7ukg:C, 7ukg:D |
10 |
1fa5:A |
128 |
30 |
0.0366 |
0.0938 |
0.4000 |
3.8 |
1fa5:B, 1fa6:A, 1fa6:B |