Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
RAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLH
RVLGSWTGDSVNYAASRFLGANQVGCSYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQL

The query sequence (length=143) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6bjv:A 148 145 0.9930 0.9595 0.9793 3.11e-103 6bjg:A, 6bjg:B, 6bjh:A, 6bjh:B, 6bjv:B, 4j39:A, 4j5v:A, 4jgn:A, 4jk0:D, 4jnx:A, 4jnx:D, 4knq:A, 4kq0:A, 4kq0:D, 4ktg:A, 1r9f:A, 1rpu:A, 1rpu:B
2 6d97:A 522 34 0.0979 0.0268 0.4118 0.027 6d97:B, 6d97:C, 6d97:D
3 6u2m:A 464 67 0.1259 0.0388 0.2687 5.2 8aht:C, 1ak8:A, 3b32:A, 7cqv:E, 5dsu:A, 2i08:A, 1j7o:A, 6jiu:C, 6jiu:F, 6jiu:I, 6jiu:L, 2kug:A, 6pjx:B, 2pq3:A, 4q57:A, 6u2m:C, 3uct:B, 3ucw:C, 3ucy:A
4 3it3:A 337 102 0.1888 0.0801 0.2647 6.5 4e3w:A, 4e3w:B, 3it0:A, 3it0:B, 3it3:B
5 1uzr:B 288 38 0.0909 0.0451 0.3421 7.4 1uzr:A, 1uzr:C
6 6hnd:B 470 32 0.0909 0.0277 0.4062 8.5 6hnd:A, 6hnv:A, 6hnv:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218