RAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETNDNPLGFKESWGFGKVVFKRYLRYDRTEASLHR
VLGSWTGDSVNYAASRFLGANQVGCSYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTP
The query sequence (length=144) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6bjv:A | 148 | 147 | 0.9931 | 0.9662 | 0.9728 | 5.30e-104 | 6bjg:A, 6bjg:B, 6bjh:A, 6bjh:B, 6bjv:B, 4j39:A, 4j5v:A, 4jgn:A, 4jk0:D, 4jnx:A, 4jnx:D, 4knq:A, 4kq0:A, 4kq0:D, 4ktg:A, 1r9f:A, 1rpu:A, 1rpu:B |
2 | 6d97:A | 522 | 34 | 0.0972 | 0.0268 | 0.4118 | 0.030 | 6d97:B, 6d97:C, 6d97:D |
3 | 6hnd:B | 470 | 31 | 0.0833 | 0.0255 | 0.3871 | 1.5 | 6hnd:A, 6hnv:A, 6hnv:B |
4 | 1e5q:A | 449 | 13 | 0.0625 | 0.0200 | 0.6923 | 4.5 | 1e5q:B, 1e5q:C, 1e5q:D, 1e5q:E, 1e5q:F, 1e5q:G, 1e5q:H |
5 | 1uzr:B | 288 | 38 | 0.0903 | 0.0451 | 0.3421 | 7.8 | 1uzr:A, 1uzr:C |