BioLiP

>protein
RAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTIS
QRIVSAQSLGEDDVE

The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1om2:A	95	95	1.0000	1.0000	1.0000	3.38e-64	3awr:A, 3ax2:A, 3ax2:C, 3ax5:C, 2v1s:D, 2v1s:E, 2v1t:A
2	5az7:A	434	67	0.6632	0.1452	0.9403	1.38e-25	3awr:B, 3ax2:E, 3ax2:G, 3ax3:A, 3ax3:G, 3ax3:C, 3ax3:E, 3ax5:A, 5az6:B, 5az6:A, 5az8:A, 2v1s:A, 2v1s:B, 2v1s:C, 2v1s:F, 2v1t:B
3	7d5c:A	919	54	0.1474	0.0152	0.2593	0.74
4	8a0c:A	1116	38	0.1158	0.0099	0.2895	1.8	8a0c:B, 8a0m:A, 8a0m:C
5	8a0m:B	964	38	0.1158	0.0114	0.2895	1.8
6	8a0m:D	975	38	0.1158	0.0113	0.2895	1.8
7	7uy7:E	783	38	0.1684	0.0204	0.4211	2.4
8	4x3l:A	260	48	0.2000	0.0731	0.3958	2.9	4x3l:B, 4x3m:A, 4x3m:B
9	6hiy:DA	1426	57	0.1579	0.0105	0.2632	5.5
10	6hiv:DA	1557	57	0.1579	0.0096	0.2632	5.6	6hiw:DA, 7pub:DA
11	6bvv:A	416	73	0.1895	0.0433	0.2466	5.7	6bw9:A, 6bwa:A, 6bwb:A, 8fub:A, 8fzm:A, 8fzm:C, 8hkw:A, 8hkw:B, 7jjl:A, 7lf4:A, 7lf4:C, 7lfc:A, 7rfy:A, 7rg5:A, 5xzx:A
12	2jae:A	478	72	0.1895	0.0377	0.2500	6.8	2jae:B, 2jb1:A, 2jb1:B, 2jb2:A, 2jb2:B, 2jb3:A, 2jb3:B
13	4b3g:A	614	62	0.1684	0.0261	0.2581	6.9	4b3g:B
14	7mq8:LH	746	45	0.1368	0.0174	0.2889	7.7	7mq9:LH, 7mqa:LH

[Back]