RAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRNGLNVSIECKRVSGLEPATVDWAFDLTKTNMQTMYEQSEWGWKDREKR
EEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKH
NHGAYQFFREALQFEIDDSSPSDCSYEILSRRTKF
The query sequence (length=195) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7kd7:A | 204 | 202 | 1.0000 | 0.9559 | 0.9653 | 7.57e-146 | 7kd7:D, 7kpu:D, 7kpu:A, 4u9v:B, 4u9w:B, 4u9w:A, 4u9w:C, 4u9w:D |
2 | 4ua3:B | 193 | 149 | 0.2564 | 0.2591 | 0.3356 | 1.12e-21 | 4ua3:A |
3 | 3ld2:B | 162 | 61 | 0.0923 | 0.1111 | 0.2951 | 0.23 | 3ld2:A, 3ld2:C, 3ld2:D |
4 | 6azq:G | 226 | 58 | 0.0718 | 0.0619 | 0.2414 | 2.2 | 6azq:H, 6azq:A, 6azq:B, 6azq:C, 6azq:D, 6azq:E, 6azs:B, 6azs:D |
5 | 6ogz:A | 1082 | 75 | 0.0872 | 0.0157 | 0.2267 | 2.2 | 6ogy:A, 6oj6:P, 2r7r:A, 2r7s:A, 2r7t:A, 2r7u:A, 2r7v:A, 2r7w:A, 2r7x:A, 2r7x:B |
6 | 2z86:C | 603 | 76 | 0.0974 | 0.0315 | 0.2500 | 2.3 | 2z86:A, 2z86:B, 2z86:D, 2z87:A, 2z87:B |
7 | 7m7f:A | 1390 | 32 | 0.0769 | 0.0108 | 0.4688 | 2.6 | 2fr0:A, 2fr1:A, 7m7i:A |
8 | 6bvc:A | 154 | 72 | 0.0821 | 0.1039 | 0.2222 | 4.1 | 1bo4:A, 1bo4:B |
9 | 6z00:A | 156 | 82 | 0.1077 | 0.1346 | 0.2561 | 5.0 | 6yzz:A, 6z00:B |
10 | 7cgv:A | 310 | 18 | 0.0513 | 0.0323 | 0.5556 | 6.3 | 7cgv:B, 7cgv:C, 7cgv:D |
11 | 1tiq:A | 173 | 59 | 0.0821 | 0.0925 | 0.2712 | 7.0 | 1tiq:B |