QVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLF
ECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWF
DDMTDTELLDLIPFFEGLSR
The query sequence (length=180) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2hhl:C | 184 | 180 | 1.0000 | 0.9783 | 1.0000 | 1.14e-132 | 2hhl:A, 2hhl:D |
2 | 1t9z:A | 181 | 170 | 0.7778 | 0.7735 | 0.8235 | 8.77e-107 | 6du2:A, 6du2:B, 6du3:A, 6du3:B, 2ghq:A, 2ghq:B, 2ght:A, 2ght:B, 3l0b:A, 3l0c:A, 3l0c:B, 3l0y:A, 3l0y:B, 3pgl:A, 3pgl:B, 1ta0:A, 4ygy:A, 4ygy:B, 4yh1:A, 4yh1:B |
3 | 2q5e:A | 181 | 167 | 0.7889 | 0.7845 | 0.8503 | 1.97e-103 | 2q5e:B, 2q5e:C, 2q5e:D, 2q5e:E, 2q5e:F, 2q5e:G, 2q5e:H |
4 | 8ujm:B | 237 | 179 | 0.4278 | 0.3249 | 0.4302 | 3.18e-43 | 8ujm:A |
5 | 4qqf:F | 191 | 155 | 0.3389 | 0.3194 | 0.3935 | 3.86e-29 | 3qle:A |
6 | 3ef1:A | 372 | 104 | 0.1444 | 0.0699 | 0.2500 | 5.26e-05 | 3ef0:A, 4xpz:A, 4xq0:A |
7 | 3shq:A | 299 | 191 | 0.2556 | 0.1538 | 0.2408 | 0.039 | |
8 | 6yjb:A | 309 | 94 | 0.1333 | 0.0777 | 0.2553 | 0.20 | 6ykf:A, 6ymg:A, 6ymg:B |
9 | 2y3a:A | 976 | 47 | 0.0889 | 0.0164 | 0.3404 | 2.9 | |
10 | 3o8o:E | 752 | 24 | 0.0611 | 0.0146 | 0.4583 | 4.3 | 3o8o:A, 3o8o:C, 3o8o:G |
11 | 7dhw:A | 726 | 63 | 0.1333 | 0.0331 | 0.3810 | 5.9 | |
12 | 8tj5:T | 801 | 23 | 0.0556 | 0.0125 | 0.4348 | 9.8 | 8tj5:R |