QTSTRWTPTTEQIKILKELYYNNAIRSPTADQIQKITARLRQFGKIEGKNVFYWFQNHKARERQKKRFN
The query sequence (length=69) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6ryd:A | 69 | 69 | 1.0000 | 1.0000 | 1.0000 | 9.93e-47 | 6ryd:B, 6ryd:E, 6ryd:F, 6ryi:A, 6ryi:B, 6ryi:C, 6ryi:D, 6ryi:E, 6ryl:A, 6ryl:B, 6ryl:C, 6ryl:D, 6ryl:E |
| 2 | 6wig:A | 84 | 66 | 0.6667 | 0.5476 | 0.6970 | 7.82e-30 | 6wig:B |
| 3 | 3q9t:A | 577 | 49 | 0.2029 | 0.0243 | 0.2857 | 0.50 | 3q9t:B, 3q9t:C, 5zu2:A, 5zu2:B, 5zu2:C, 5zu3:A, 5zu3:B, 5zu3:C |
| 4 | 8isk:B | 848 | 19 | 0.1159 | 0.0094 | 0.4211 | 1.6 | 8isk:A |
| 5 | 6ayo:A | 229 | 39 | 0.1739 | 0.0524 | 0.3077 | 2.3 | 6ayo:B, 6ayq:A, 6ayq:B, 6ayr:A, 6ayr:B, 6ayr:C, 6ayr:D, 6ays:A, 6ays:B, 6ays:C, 6ays:G, 6ays:D, 6ays:H, 6ays:E, 6ays:F, 6ayt:A, 6ayt:B, 6ayt:C, 6ayt:D |
| 6 | 5hod:A | 61 | 62 | 0.2754 | 0.3115 | 0.3065 | 2.5 | 5hod:D |
| 7 | 2acl:H | 244 | 22 | 0.1449 | 0.0410 | 0.4545 | 4.1 | 2acl:B, 2acl:D, 2acl:F, 5avi:A, 5avi:C, 5avl:A, 3fal:B, 3fal:D, 3fc6:B, 3fc6:D, 5hjs:A, 5hjs:B, 3ipq:A, 3ips:A, 3ips:B, 3ipu:A, 3ipu:B |
| 8 | 5inj:A | 355 | 28 | 0.1304 | 0.0254 | 0.3214 | 6.8 | 5k9m:A |
| 9 | 7w8w:A | 346 | 28 | 0.1304 | 0.0260 | 0.3214 | 7.3 | 7w8v:A, 7w8x:A, 7w8y:A |
| 10 | 2oo0:A | 419 | 22 | 0.1304 | 0.0215 | 0.4091 | 9.4 | 5bwa:A, 7odc:A, 2on3:A, 2on3:B, 2oo0:B, 7s3f:A, 7s3f:B, 7s3g:A, 7s3g:B, 7u6p:A, 7u6p:B, 7u6u:A, 7u6u:B, 4zgy:A |
| 11 | 3rqg:C | 212 | 21 | 0.1739 | 0.0566 | 0.5714 | 9.7 | 3ajm:B, 3rqe:C, 3rqf:A, 4tvq:C |
| 12 | 8iff:A | 868 | 18 | 0.1014 | 0.0081 | 0.3889 | 9.9 | 8f5z:B, 8f5z:A, 8iff:B, 8isj:A, 8isj:B |
umich.edu