QTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQL
PGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATSLEQGQNVTAYFNADSVIIAT
The query sequence (length=137) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 1o7l:B | 256 | 137 | 0.9927 | 0.5312 | 0.9927 | 1.26e-97 | 1h9r:A, 1h9r:B, 1h9s:A, 1h9s:B, 1o7l:A, 1o7l:C, 1o7l:D |
| 2 | 1h9m:A | 141 | 139 | 0.3650 | 0.3546 | 0.3597 | 5.64e-17 | 1h9m:B |
| 3 | 2jda:B | 142 | 51 | 0.1095 | 0.1056 | 0.2941 | 0.25 | 2jd9:A, 2jda:A |
| 4 | 1dhr:A | 236 | 75 | 0.1387 | 0.0805 | 0.2533 | 1.4 | 1dir:A, 1dir:B, 1dir:C, 1dir:D, 1hdr:A |
| 5 | 3mte:A | 219 | 35 | 0.0949 | 0.0594 | 0.3714 | 3.1 | 3mte:B, 4ox9:Y, 3p2e:A, 3p2e:B, 3p2k:A, 3p2k:B, 3p2k:C, 3p2k:D, 3pb3:A, 3pb3:B |
| 6 | 5crw:A | 242 | 27 | 0.0803 | 0.0455 | 0.4074 | 6.1 | |
| 7 | 3loq:A | 273 | 67 | 0.1168 | 0.0586 | 0.2388 | 6.7 | 3loq:B |
| 8 | 1fqt:A | 109 | 28 | 0.0876 | 0.1101 | 0.4286 | 7.1 | 1fqt:B |
| 9 | 4oli:A | 539 | 85 | 0.1752 | 0.0445 | 0.2824 | 7.4 | 6aam:A, 7ax4:A, 7ax4:B, 5c03:A, 5c03:B, 6dbk:A, 6dbm:A, 5f1z:A, 5f20:A, 4gfo:A, 4gih:A, 4gii:A, 4gj2:A, 4gj3:A, 4gvj:A, 7k7o:A, 7k7o:B, 7k7q:A, 7k7q:B, 3lxn:A, 3lxp:A, 6nsl:A, 6nsl:B, 3nyx:A, 3nz0:A, 6nze:A, 6nze:B, 6nzf:A, 6nzf:B, 6nzh:A, 6nzh:B, 6nzp:A, 6nzp:B, 6nzq:A, 6nzq:B, 6nzr:A, 6nzr:B, 6ova:A, 4py1:A, 8s98:A, 8s98:B, 8s98:C, 8s99:A, 8s99:B, 8s99:C, 8s9a:A, 8s9a:B, 8s9a:C, 8tb5:A, 8tb5:B, 8tb6:A, 8tb6:B, 5tkd:A, 5tkd:B, 7uyr:A, 7uys:A, 7uyt:A, 7uyu:A, 6vns:A, 6vnv:A, 6vnx:A, 6vny:A, 5wal:A, 4wov:A, 4wov:B, 6x8f:A, 6x8f:C, 6x8g:A, 3zon:A |
| 10 | 2j0w:A | 447 | 36 | 0.0876 | 0.0268 | 0.3333 | 7.6 | 2j0x:A, 2j0x:B |
| 11 | 6sga:FA | 579 | 44 | 0.1022 | 0.0242 | 0.3182 | 8.4 | 6sgb:FA |
| 12 | 6nor:A | 349 | 66 | 0.1460 | 0.0573 | 0.3030 | 8.7 | 6nor:B, 6nor:C, 6nor:D, 6nor:E, 6nor:F |
| 13 | 1sf2:A | 425 | 46 | 0.1095 | 0.0353 | 0.3261 | 8.7 | 1sf2:B, 1sf2:C, 1sf2:D, 1sff:A, 1sff:B, 1sff:C, 1sff:D, 1szk:A, 1szk:B, 1szk:C, 1szk:D, 1szs:A, 1szs:B, 1szs:C, 1szs:D, 1szu:A, 1szu:B, 1szu:C, 1szu:D |
| 14 | 5tuk:B | 373 | 39 | 0.1022 | 0.0375 | 0.3590 | 8.8 | 5tuk:A, 5tuk:C, 5tuk:D |
umich.edu