QTKIQKYAGTAMPYPNRTGMTPFYINHLGRHGARFPTSRKALDKVEKVLVSAQQENGLTSEGMALLSMIRRLSRLFDGQW
GKLSKLGETEQEGIAGRMIRNYPQLFSNSAKIEAIATYVPRSINSMDAFLSCMIRHNPALQVQRSEGKQYNHILRFFDLN
KSYVNYKEKGDWLPIYKAFVHKKISPVPIMKKFLLNPEQYLDKEAEEFVMALFSVAAILPDTSIPLNLEDLFTLDEWHRY
WQTQNLRQYMSKSSAPVGKMLPVAIAWPLLSEFIRSAQEVISGKSDYQANFRFAHAETVIPFVSLMGIEKTDVQVCRPDS
VSVYWKDYEISPMAANVQWLFYRDRDQRIWVKILLNEEAAALPISTACFPYYSWEKTRIFFNQRIEMAKKTLSVFN
The query sequence (length=396) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4fdt:A | 398 | 397 | 1.0000 | 0.9950 | 0.9975 | 0.0 | 4fdt:B, 4fdu:A, 4fdu:B |
2 | 7r5y:E | 414 | 374 | 0.2576 | 0.2464 | 0.2727 | 2.14e-43 | 7r5y:A, 7r5y:B, 7r5y:C, 7r5y:D, 7r5y:F |
3 | 7zgh:A | 413 | 384 | 0.2500 | 0.2397 | 0.2578 | 1.52e-20 | 7zgh:B |
4 | 6rxd:A | 509 | 187 | 0.1313 | 0.1022 | 0.2781 | 2.67e-13 | 6rxd:B, 6rxe:A, 6rxe:B, 6rxf:A, 6rxf:B, 6rxg:A, 6rxg:B |
5 | 6rxd:A | 509 | 104 | 0.0631 | 0.0491 | 0.2404 | 0.28 | 6rxd:B, 6rxe:A, 6rxe:B, 6rxf:A, 6rxf:B, 6rxg:A, 6rxg:B |
6 | 3k4q:A | 438 | 270 | 0.1641 | 0.1484 | 0.2407 | 0.050 | 3k4q:B |
7 | 6ywe:C | 307 | 143 | 0.1010 | 0.1303 | 0.2797 | 0.38 | 6yws:C, 6ywv:C, 6ywx:C, 6ywy:C |
8 | 4pht:Y | 226 | 87 | 0.0657 | 0.1150 | 0.2989 | 0.41 | 4pht:X, 4pht:Z |
9 | 1sk8:A | 435 | 270 | 0.1591 | 0.1448 | 0.2333 | 3.1 | 1sk9:A |
10 | 5xpd:A | 269 | 91 | 0.0556 | 0.0818 | 0.2418 | 3.9 | |
11 | 4cej:B | 1156 | 33 | 0.0354 | 0.0121 | 0.4242 | 4.3 | 4ceh:B, 4cei:B, 3u44:B, 3u4q:B |
12 | 3it3:A | 337 | 96 | 0.0581 | 0.0682 | 0.2396 | 5.4 | 4e3w:A, 4e3w:B, 3it0:A, 3it0:B, 3it3:B |
13 | 6j9b:A | 106 | 70 | 0.0505 | 0.1887 | 0.2857 | 6.3 | 6j9b:D |
14 | 5x20:A | 312 | 69 | 0.0505 | 0.0641 | 0.2899 | 6.4 | 3wfj:A, 3wfj:B, 3wfj:C, 3wfj:D, 3wfj:E, 3wfj:G, 5x20:B, 5x20:C, 5x20:D, 5x20:E |
15 | 2v9k:A | 467 | 61 | 0.0556 | 0.0471 | 0.3607 | 8.9 |