BioLiP

>protein
QTIKIGAQSMSESEIIASMLGQLIEHHTDLKTTTIKNLGSNAVQQQALMNGEIDIAATRYTGDALTGTLRMEPEKDPDKA
LALTQREFKKRYDLKWYDSYGFDNTYAFTVSKELADQYHLETVSDVKKWAPQLKLGVDNYWMKLKGNGYQDFTKTYGMTF
GGTYPMQIGLVYDAVKSGKMDIVLAYSTDGRIKSYGLKMLKDDKQFFPPYDCSPVVPEKVLKEHPELEGIIKKMLGKIDT
ATMQELNYEVDGNLKEPSVVAKEYLEKHRYFE

The query sequence (length=272) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6eyh:A	280	272	0.9963	0.9679	0.9963	0.0	6eyl:A, 6eyl:B, 5nxy:A, 5nxy:C, 3r6u:A
2	3ppo:A	272	271	0.7243	0.7243	0.7269	2.11e-150	3ppo:B, 3ppq:A, 3ppq:B, 3ppr:A, 3ppr:B
3	7s7x:A	278	270	0.3787	0.3705	0.3815	5.79e-61	7s7x:B, 7s7x:C, 6v1r:A
4	7txl:A	275	270	0.3456	0.3418	0.3481	1.49e-46	7txk:A, 7txk:B, 7txl:B
5	7s7t:A	509	192	0.2757	0.1473	0.3906	1.75e-44	8i4o:A, 8i4o:C, 8i4o:E, 8i4o:G, 8i4o:I, 8i4o:K
6	7s7t:A	509	102	0.1250	0.0668	0.3333	7.08e-06	8i4o:A, 8i4o:C, 8i4o:E, 8i4o:G, 8i4o:I, 8i4o:K
7	8dp7:A	265	264	0.3162	0.3245	0.3258	8.91e-42	8dp7:B, 8dp7:C, 8dp7:D, 8dp7:E
8	1sw1:A	270	270	0.2904	0.2926	0.2926	8.39e-31	1sw1:B, 1sw4:A, 1sw4:B
9	2oje:D	214	75	0.0735	0.0935	0.2667	6.8	2icw:G, 2icw:H, 2oje:H, 1r5i:D, 1r5i:H
10	3p0j:A	657	48	0.0551	0.0228	0.3125	8.0	3p0h:B, 3p0i:B, 3p0j:B
11	5usf:A	682	48	0.0551	0.0220	0.3125	8.3	3p0h:A, 3p0i:A, 3p0j:C, 3p0j:D, 5usf:B

[Back]