QRVGARLAARAQIRDIRLLRTQAAVHRAPKPAQGLTYDLEFEPAVDADPATISAFVVRISCHLRIQNQATQDVATADFEF
AALFDYHLEDDPTEEELTAYAATTGRFALYPYIREYVYDLTGRLALPPLTLEILSRPM
The query sequence (length=138) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5mtw:C | 138 | 138 | 1.0000 | 1.0000 | 1.0000 | 1.91e-97 | 5mtw:A, 5mtw:D, 5mtw:B |
2 | 7ook:C | 373 | 95 | 0.1812 | 0.0670 | 0.2632 | 2.8 | 7ook:B, 7ook:A |
3 | 3hfr:A | 266 | 54 | 0.1304 | 0.0677 | 0.3333 | 3.6 | 3hfr:B |
4 | 6uv8:A | 183 | 31 | 0.0797 | 0.0601 | 0.3548 | 4.4 | 6uvb:A |
5 | 5ein:A | 344 | 30 | 0.1014 | 0.0407 | 0.4667 | 5.2 | 5ein:B, 5eio:A, 5eio:B, 2ozp:A |
6 | 8gix:E | 991 | 28 | 0.1014 | 0.0141 | 0.5000 | 6.6 | |
7 | 1ozb:A | 144 | 23 | 0.0797 | 0.0764 | 0.4783 | 7.1 | 1ozb:B, 1ozb:C, 1ozb:D |