BioLiP

>protein
QRIYSSIEEIIQQAQASEIGQKKEFYVYGNLVSIQMKNKLYYYRCTCQGKSVLKYHGDSFFCESCQQFINPQVHLMLRAF
VQDSTGTIPVMIFDQQSSQLINQIDPSIHVQEAGQYVKNCIENGQEEIIRQLFSKLDFARFIFEIQFENKEFNNEQEIAY
KVLKIEKENIKEESKYLLKKLEHLI

The query sequence (length=185) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8gap:D	187	185	1.0000	0.9893	1.0000	3.37e-134	6d6v:D, 7lma:D, 7lmb:D, 3u50:C, 7uy5:D, 7uy6:D
2	6i52:C	178	185	0.2108	0.2191	0.2108	9.28e-06
3	4gnx:C	433	88	0.1459	0.0624	0.3068	1.37e-05	4gnx:Z, 4gop:C, 4gop:Z
4	6z1p:BI	1413	64	0.1081	0.0142	0.3125	0.70
5	8apo:Yc	159	39	0.0649	0.0755	0.3077	1.3
6	1zdl:A	484	71	0.1081	0.0413	0.2817	1.8	3dgz:A, 1zkq:A
7	7z6w:A	188	56	0.0757	0.0745	0.2500	2.3	1iwl:A, 7z6x:A
8	5k2m:G	273	55	0.0703	0.0476	0.2364	2.7	5k2m:I, 5k2m:A, 5k2m:B, 5k2m:C, 5k2m:D, 5k2m:H, 5k2m:J
9	5ah5:A	789	54	0.1027	0.0241	0.3519	4.1	5ah5:B
10	7cui:A	173	49	0.0919	0.0983	0.3469	6.3	7cui:C
11	2inc:A	491	41	0.0757	0.0285	0.3415	8.7	2ind:A, 3n1x:A, 3n1y:A, 3n1z:A, 3n20:A, 2rdb:A, 3rn9:A, 3rna:A, 3rnb:A, 3rnc:A, 3rne:A, 3rnf:A, 3rng:A, 1t0q:A, 1t0r:A, 1t0s:A
12	2fze:A	373	20	0.0595	0.0295	0.5500	9.4	2fze:B, 2fzw:A, 2fzw:B, 8gv3:A, 8gv3:B, 1m6h:A, 1m6h:B, 1m6w:A, 1m6w:B, 1ma0:A, 1ma0:B, 1mc5:A, 1mc5:B, 1mp0:A, 1mp0:B, 3qj5:A, 3qj5:B, 1teh:A, 1teh:B
13	5m21:H	333	58	0.0973	0.0541	0.3103	9.4	5m21:B, 5m21:D, 5m21:F, 5m22:B, 5m22:D, 5m22:F, 5m22:H, 5m26:B, 5m26:D, 5m26:F, 5m26:H, 5m4o:B, 5m4o:D, 5m4o:F, 5m4o:H

[Back]