BioLiP

>protein
QQVIKDLFYVVPLSRNCEKIYKNKTHILLGISPFNSKFSQNYIHQLIDWSSKNFKNVTVLLAGDEAKNLLEALGTPTTKA
ERKVRKEIRRHFRFSEEALRKNGREIDIYTFSDFKNNKIYNEVYQNVIYYFEKDEKFRKSCLAMSHDALSSAAKSLNMED
IEITDNMLFHAVKYVLAELPFFLSGASILGYKESVLAYHRPWKLGEKIKNSEFYIKMSDNQGYIILKQIN

The query sequence (length=230) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7azu:A	230	230	1.0000	1.0000	1.0000	7.16e-173	6ztu:A
2	3oqj:B	220	222	0.4957	0.5182	0.5135	3.51e-80	3oqj:A
3	4q24:A	224	211	0.2304	0.2366	0.2512	7.76e-16
4	7rd1:J	942	50	0.0652	0.0159	0.3000	1.8	7rd1:L, 7rd1:A, 7rd1:C, 7rd1:D, 7rd1:F, 7rd1:B, 7rd1:E, 7rd1:G, 7rd1:H, 7rd1:K, 7rd1:I
5	2obe:A	915	50	0.0652	0.0164	0.3000	1.8	2obe:B, 2obe:C
6	6rxu:UT	2033	62	0.0826	0.0093	0.3065	2.9	6rxv:UT, 6rxx:UT, 6rxz:UT
7	6cbd:A	787	145	0.1739	0.0508	0.2759	3.8	5wea:A
8	7yav:A	501	44	0.0652	0.0299	0.3409	4.1	7yav:B
9	6hr8:A	397	39	0.0435	0.0252	0.2564	4.6	6hr8:B, 6hr8:C, 6hr8:D, 6hr8:E, 6hr8:F
10	3qde:A	811	95	0.0870	0.0247	0.2105	4.8	8ho8:A, 8ho8:B, 3qde:B
11	5twa:A	161	53	0.0739	0.1056	0.3208	6.3	5twa:B
12	6s8f:F	2571	37	0.0609	0.0054	0.3784	6.8	7mq8:NR, 7mq9:NR, 7mqa:NR, 6s8f:H
13	5ecg:C	227	30	0.0478	0.0485	0.3667	7.9	5ecg:D, 1gzh:D

[Back]