QQLIRQLRTGLGAEAVNKAAEIVRAHVADPQAQSATVDRFLSELEQMAPSSTSRLRAASRQSLAALVEKFDSVAGGLDAD
GLTNLADELASVAKLLLSETALNKHLAEPTDDSAPKVRLLERLLSDKVSATTLDLLRTAVSNRWSTESNLIDAVEHTARL
ALLKRAEIAGEVDEVEEQLFRFGRVLDAEPRLSALLSDYTTPAEGRVALLDKALTGRPGVNQTAAALLSQTVGLLRGERA
DEAVIDLAELAVSRRGEVVAHVSAAAELSDAQRTRLTEVLSRIYGRPVSVQLHVDPELLGGLSITVGDEVIDGSIASRLA
AAQTGLP
The query sequence (length=327) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7nkl:d | 327 | 327 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 6z1u:S | 187 | 176 | 0.1468 | 0.2567 | 0.2727 | 6.86e-09 | 2jmx:A |
3 | 6tmi:G | 180 | 74 | 0.0734 | 0.1333 | 0.3243 | 2.30e-04 | |
4 | 2fps:B | 163 | 51 | 0.0520 | 0.1043 | 0.3333 | 0.48 | 2fpr:A, 2fpr:B, 2fps:A, 2fpu:A, 2fpu:B, 2fpw:A, 2fpw:B, 2fpx:A, 2fpx:B |
5 | 8egr:H | 313 | 110 | 0.0765 | 0.0799 | 0.2273 | 2.8 | 8egr:G |
6 | 1dxm:A | 131 | 104 | 0.0795 | 0.1985 | 0.2500 | 4.3 | 1dxm:B, 1hpc:A, 1hpc:B, 1htp:A |
7 | 4itr:A | 299 | 110 | 0.0734 | 0.0803 | 0.2182 | 5.9 | 4itr:B, 3n3u:A, 6siu:B, 6siu:A |