QPKPGFCVKTNSSEGKVFINICHSPSIPPPADGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSNFYLRMQNSDFLRELVV
TIAREGLEDKYGLQLNPEWRMLKYRSFLGSIS
The query sequence (length=112) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4cse:B | 112 | 112 | 1.0000 | 1.0000 | 1.0000 | 1.40e-82 | 4cse:A |
2 | 4cv4:A | 133 | 127 | 1.0000 | 0.8421 | 0.8819 | 3.11e-79 | 4ckt:A, 4ckt:B |
3 | 4psi:A | 125 | 111 | 0.8750 | 0.7840 | 0.8829 | 5.23e-71 | 4psi:B |
4 | 8aw3:3 | 279 | 56 | 0.1607 | 0.0645 | 0.3214 | 0.95 | |
5 | 4uc0:A | 247 | 82 | 0.1607 | 0.0729 | 0.2195 | 3.3 | |
6 | 2yxx:A | 385 | 53 | 0.1696 | 0.0494 | 0.3585 | 6.1 | |
7 | 7d50:B | 255 | 32 | 0.1161 | 0.0510 | 0.4062 | 6.3 | 7d4r:A, 7d50:A, 7d53:A, 7d53:B, 7d53:C, 7d53:D |
8 | 4zgf:A | 141 | 95 | 0.2589 | 0.2057 | 0.3053 | 7.2 | |
9 | 6f2f:A | 166 | 72 | 0.1964 | 0.1325 | 0.3056 | 9.2 | 6f2f:B, 6f2f:C, 6f2h:A, 6f2h:B, 6f2h:E, 6f2h:F, 6f2h:G, 6f2h:I, 6f2h:J, 6f2h:K, 6f2h:L, 6hf6:A, 6hf6:B, 6hf6:C |
10 | 5z0q:C | 379 | 23 | 0.0714 | 0.0211 | 0.3478 | 9.7 | 5z0q:A, 5z0q:B, 5z0q:D, 5z0q:E, 5z0q:F, 5z0q:G, 5z0q:H, 5z0q:I, 5z0q:J, 5z0q:K, 5z0q:L |