QPAAIEAFINSPEFQKNIRMRDIEKNKIGSGSGTVYRLHDDFVVKIPVNEGIRNSHPDRVSKYLNMANDDKNFSRSAIMN
INGKDVTVLVSKYIQGQEFDVEDEDNYRMAEALLKSRGVYMHDINLGNILVKEGVLFFVDGDQIVLSQE
The query sequence (length=149) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8jbi:C | 157 | 157 | 1.0000 | 0.9490 | 0.9490 | 8.54e-100 | 8jbi:D, 8jbi:A, 8jbi:B |
2 | 2ct8:A | 465 | 68 | 0.1275 | 0.0409 | 0.2794 | 1.3 | 2csx:A, 2csx:B, 2ct8:B |
3 | 8wgo:A | 869 | 33 | 0.1074 | 0.0184 | 0.4848 | 1.8 | 8w7j:A, 8wgo:B |
4 | 8w7a:B | 804 | 33 | 0.1074 | 0.0199 | 0.4848 | 1.9 | |
5 | 4gf3:A | 123 | 39 | 0.0872 | 0.1057 | 0.3333 | 4.2 | 1ttw:A |
6 | 7rpx:E | 590 | 34 | 0.1141 | 0.0288 | 0.5000 | 6.5 | 2hix:A, 7rpo:E, 7rpw:E |