QNQPHTEVGTARPCRSCKWQTPDPTDPHRGQCTANRHAMGGVWKRWLRDVENTTCSRHEEGKLSFRDHV
The query sequence (length=69) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5bwe:B | 69 | 69 | 1.0000 | 1.0000 | 1.0000 | 2.83e-48 | 5bwe:F, 4pkf:B |
2 | 3c25:A | 354 | 26 | 0.1594 | 0.0311 | 0.4231 | 1.8 | 3bvq:A, 3bvq:B, 3c25:B |
3 | 6s9f:B | 300 | 27 | 0.1884 | 0.0433 | 0.4815 | 3.6 | 6s9f:A |
4 | 4mpg:B | 252 | 26 | 0.1739 | 0.0476 | 0.4615 | 5.9 | 1ljr:A, 1ljr:B, 3ljr:A, 3ljr:B, 4mpg:A |
5 | 2ghf:A | 102 | 22 | 0.1304 | 0.0882 | 0.4091 | 6.4 |