QNETAKRELEEYIADKKAEINPRYRPHYHISPPVGWMNAPNGFSYYKGKFHLFYQFYPYDSVWGPMHWGHVSSSNLIDWE
The query sequence (length=464) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
7bwc:A |
464 |
464 |
1.0000 |
1.0000 |
1.0000 |
0.0 |
|
2 |
7vcp:A |
490 |
457 |
0.3491 |
0.3306 |
0.3545 |
9.96e-87 |
|
3 |
3pij:B |
526 |
490 |
0.3405 |
0.3004 |
0.3224 |
1.26e-69 |
3pij:A |
4 |
1w2t:A |
432 |
450 |
0.3190 |
0.3426 |
0.3289 |
1.66e-64 |
1w2t:B, 1w2t:C, 1w2t:D, 1w2t:E, 1w2t:F |
5 |
6nun:A |
516 |
478 |
0.3233 |
0.2907 |
0.3138 |
2.22e-64 |
|
6 |
6nu8:A |
488 |
443 |
0.2780 |
0.2643 |
0.2912 |
2.30e-52 |
|
7 |
2ac1:A |
537 |
408 |
0.2716 |
0.2346 |
0.3088 |
1.72e-37 |
2oxb:A, 2qqu:A, 2qqv:A, 2qqw:A, 2xqr:A, 2xqr:C, 2xqr:G, 2xqr:K, 2xqr:E, 2xqr:I |
8 |
1y9g:A |
517 |
491 |
0.2888 |
0.2592 |
0.2729 |
7.52e-35 |
|
9 |
2add:A |
537 |
429 |
0.2780 |
0.2402 |
0.3007 |
5.10e-34 |
2ade:A, 2aey:A, 2aez:A |
10 |
6s1t:A |
512 |
339 |
0.2284 |
0.2070 |
0.3127 |
2.25e-32 |
3kf3:A, 3kf3:B, 6s1t:B, 6s2b:A, 6s2b:B, 3u14:A, 3u14:B, 3u75:A, 3u75:B, 3u75:C, 3u75:D |
11 |
8beq:A |
534 |
294 |
0.2026 |
0.1760 |
0.3197 |
5.72e-31 |
8beq:B, 8bes:A, 8bes:B, 8bes:C, 8bes:D, 8bet:A, 8bet:B, 8bet:C, 8bet:D, 8beu:A, 8beu:B, 8beu:C, 8beu:D |
12 |
3rwk:X |
493 |
479 |
0.2780 |
0.2617 |
0.2693 |
9.54e-31 |
3sc7:X |
13 |
3ugg:A |
524 |
345 |
0.2284 |
0.2023 |
0.3072 |
2.37e-30 |
3ugg:B, 3ugh:B |
14 |
4ffg:A |
480 |
319 |
0.2026 |
0.1958 |
0.2947 |
6.85e-16 |
4ffg:B, 4ffg:C, 4ffg:D, 4ffh:A, 4ffh:B, 4ffh:C, 4ffh:D, 4ffi:A, 4ffi:B, 4ffi:C, 4ffi:D |
15 |
5fix:A |
624 |
253 |
0.1401 |
0.1042 |
0.2569 |
1.82e-08 |
5fix:B, 6fje:B, 6fje:A, 6fjg:A, 6fjg:B, 5fk7:A, 5fk7:B, 5fk8:A, 5fk8:B, 5fkb:A, 5fkb:B, 5fkc:A, 5fkc:B, 5fmb:A, 5fmb:B, 5fmc:A, 5fmc:B, 5fmd:A, 5fmd:B, 5nsl:A, 5nsl:B, 5o47:B, 5o47:A, 6s2g:A, 6s2g:B, 6s2h:A, 6s2h:B, 6s3z:A, 6s3z:B, 6s82:A, 6s82:B |
16 |
8aa2:E |
497 |
240 |
0.1250 |
0.1167 |
0.2417 |
1.90e-04 |
8aa2:M, 6r3r:A, 6r3u:A, 7znr:A, 7znr:B, 7zns:A, 7zns:B |
17 |
7fir:C |
304 |
134 |
0.0668 |
0.1020 |
0.2313 |
0.002 |
7fip:A, 7fip:B, 7fip:C, 7fip:D, 7fiq:C, 7fiq:B, 7fiq:A, 7fiq:D, 7fir:A, 7fir:B, 7fir:D, 7fis:C, 7fis:B, 7fis:A, 7fis:D |
18 |
6ccg:A |
72 |
68 |
0.0409 |
0.2639 |
0.2794 |
0.18 |
6cc8:A, 6cc8:B, 6ccg:B, 6ceu:A, 6ceu:B, 6cev:A, 6cev:B |
19 |
7q86:A |
612 |
37 |
0.0388 |
0.0294 |
0.4865 |
2.7 |
7q86:B |
20 |
6ha8:8 |
212 |
58 |
0.0345 |
0.0755 |
0.2759 |
2.7 |
|
21 |
2qm9:A |
139 |
52 |
0.0366 |
0.1223 |
0.3269 |
4.0 |
|
22 |
7xhn:I |
517 |
49 |
0.0259 |
0.0232 |
0.2449 |
5.0 |
|
23 |
6v7w:E |
234 |
51 |
0.0366 |
0.0726 |
0.3333 |
5.6 |
6d6a:A, 6d6a:B, 6d6a:C, 6d6a:D, 6d6a:E, 6d6a:F, 6d6a:G, 6d6a:H, 6d6b:A, 6d6b:B, 6d6b:C, 6d6b:D, 6d6b:E, 6d6b:F, 6d6b:G, 6d6b:H, 6d6c:A, 6d6c:B, 6d6c:C, 6d6c:D, 6d6c:E, 6d6c:F, 6d6c:G, 6d6c:H, 6d6c:I, 6d6c:J, 6d6c:K, 6d6c:L, 6d6d:A, 6d6d:B, 6d6l:A, 6d6l:B, 6d6l:C, 6d6l:D, 6d6m:A, 6d6m:B, 6d6m:C, 6d6m:D, 6d6n:A, 6d6n:B, 6d6n:C, 6d6n:D, 6d6o:A, 6d6o:B, 6d6o:C, 6d6o:D, 6d6p:A, 6d6p:B, 6d6p:C, 6d6p:D, 3ix3:A, 3ix3:B, 3ix4:A, 3ix4:B, 3ix4:C, 3ix4:D, 3ix4:E, 3ix4:F, 3ix4:G, 3ix4:H, 3ix8:A, 3ix8:B, 3ix8:C, 3ix8:D, 3jpu:A, 3jpu:B, 3jpu:C, 3jpu:D, 3jpu:E, 6mvm:A, 6mvm:B, 6mvn:A, 6mvn:B, 6mwh:A, 6mwh:B, 6mwl:A, 6mwl:B, 6mww:A, 6mww:B, 6mwz:A, 6mwz:B, 4ng2:A, 4ng2:B, 4ng2:C, 4ng2:D, 2uv0:E, 2uv0:F, 2uv0:G, 2uv0:H, 6v7w:B, 6v7x:B |
24 |
6czy:A |
362 |
60 |
0.0409 |
0.0525 |
0.3167 |
6.0 |
6czy:B, 6czy:C, 6czy:D, 6czz:A, 6czz:B, 6czz:C, 6czz:D |
25 |
7lwb:A |
182 |
84 |
0.0603 |
0.1538 |
0.3333 |
7.1 |
7bwt:B, 4lhv:A, 4lhv:B, 4lhv:C, 4lhv:D, 4lhw:A, 4lhw:B, 4lhw:C, 4lhw:D, 4lhw:E, 4lhy:A, 4lhy:B, 4lhz:A, 4lhz:B, 4li0:A, 4li0:B, 3qbt:A, 3qbt:C, 3qbt:E, 3qbt:G, 6rir:A, 6rir:B, 6sq2:A, 6sq2:B, 6stf:A, 6stf:B, 6stf:C, 6stf:D, 6stf:E, 6stg:A, 6stg:B, 5szi:A, 3tnf:A, 6whe:A, 6whe:B, 6yx5:A, 6zsi:A, 6zsi:B, 6zsj:A, 6zsj:B |
26 |
7qoo:I |
618 |
49 |
0.0259 |
0.0194 |
0.2449 |
7.3 |
|
27 |
1is2:A |
637 |
37 |
0.0366 |
0.0267 |
0.4595 |
8.0 |
2ddh:A, 1is2:B |