QMKKYATDTKCLDYLSTFRTEVEDQIANYKVALVSQMRRQLTERLVEKLNGIQQAEKLIQGSLQDVMIREIVSSFKDLYK
SRPELHDAAMQSAIQGLSMDPVGAHFKASLQELAKVNLSTATADPMGTVVQRVAAVFQKREKEFLDTFTVKATEAQEIKT
IVDKCHKGNTFDFHALSDEELRRLEQLYSTVNNRVGFETIHENSIKPVAPLSENSKGFVEFVNTQLEITKAKLRNARLTA
FAHAFV
The query sequence (length=246) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6tmi:B | 246 | 246 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 8c83:x | 259 | 64 | 0.0894 | 0.0849 | 0.3438 | 0.33 | 8cah:G, 8cas:x, 8cbj:K |
3 | 1ued:A | 391 | 39 | 0.0691 | 0.0435 | 0.4359 | 2.2 | 1ued:B |
4 | 3v70:A | 217 | 95 | 0.1057 | 0.1198 | 0.2737 | 2.3 | 3v70:B |
5 | 2v45:A | 723 | 73 | 0.0691 | 0.0235 | 0.2329 | 4.9 | 2jim:A, 2jio:A, 2jip:A, 2jiq:A, 2jir:A, 2nap:A, 2v3v:A |
6 | 7jrl:A | 457 | 39 | 0.0488 | 0.0263 | 0.3077 | 6.5 | 7jrm:A |
7 | 3o2g:A | 386 | 125 | 0.1260 | 0.0803 | 0.2480 | 9.6 | 4bg1:A, 4bgk:A, 4bgm:A, 4bhf:A, 4bhg:A, 4bhi:A, 4c5w:A, 4c8r:A, 4c8r:B, 4c8r:C, 4c8r:D, 4c8r:E, 4c8r:F, 4cwd:A, 3ms5:A, 3n6w:A |