Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
QLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRKVKRRWDDDVVFKNCAKGVDDQKKDK
RFVNDTLRSEFHKKFMEKYIK

The query sequence (length=101) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6id0:P 118 101 0.9505 0.8136 0.9505 1.45e-64 8c6j:P, 8ch6:Q, 6ff4:R, 6ff7:R, 8i0s:P, 8i0t:P, 8i0u:P, 8i0v:P, 8i0w:P, 6icz:P, 6id1:P, 5mqf:R, 7qtt:Q, 7w59:P, 7w5a:P, 7w5b:P, 5xjc:P, 5yzg:P, 5z56:P, 5z57:P
2 6zym:R 87 101 0.8416 0.9770 0.8416 2.54e-54
3 9fmd:P 106 101 0.8218 0.7830 0.8218 1.44e-51 6qdv:P
4 8ro2:P 112 112 0.8416 0.7589 0.7589 7.85e-42
5 8ro0:P 150 126 0.6436 0.4333 0.5159 4.16e-37 8ro1:P
6 3jb9:h 90 96 0.4950 0.5556 0.5208 3.74e-25
7 4w8j:A 1017 61 0.1782 0.0177 0.2951 0.24 4arx:A, 4arx:D, 4arx:B, 4arx:C, 4ary:A, 4ary:B, 4ary:C, 4ary:D
8 7b9v:P 74 24 0.0792 0.1081 0.3333 0.25 6bk8:H, 7dco:S, 6exn:P, 5gm6:S, 5gmk:S, 6j6g:S, 6j6h:S, 6j6n:S, 6j6q:S, 5lj3:P, 5lj5:P, 5mps:P, 5mq0:P, 5wsg:S, 5y88:P, 5ylz:P
9 8dqx:C 330 57 0.1683 0.0515 0.2982 0.87 8dqw:C, 8dqz:C, 8dr0:C, 8dr1:C, 8dr3:C, 8dr4:C, 8dr5:C, 8dr6:C, 8dr7:C, 8fs3:C, 8fs4:C, 8fs5:C, 8fs6:C, 8fs7:C, 8fs8:C, 7sgz:C, 7sh2:C, 7st9:C, 7stb:C, 7ste:C, 1sxj:C, 7tfh:C, 7tfi:C, 7tfj:C, 7tfk:C, 7tfl:C, 7thj:C, 7thv:C, 8thb:C, 8thc:C, 8thd:C, 7ti8:C, 7tib:C, 7tic:C, 7tid:C, 7tku:C, 8tw7:3, 8tw8:3, 8twa:3, 8twb:3, 7u19:C, 7u1a:C, 7u1p:C
10 3rde:A 552 67 0.1782 0.0326 0.2687 1.1 3rde:B, 3rde:C, 3rde:D
11 8y6o:I 597 28 0.1485 0.0251 0.5357 5.2 8qp8:G, 6qw6:5X, 6qx9:5X, 8r08:G
12 4xyj:A 768 70 0.1881 0.0247 0.2714 9.2 4rh3:A, 4rh3:B, 4rh3:C, 4rh3:D, 4u1r:A, 4u1r:B, 4u1r:C, 4u1r:D, 4wl0:A, 4wl0:B, 4wl0:C, 4wl0:D, 4xyj:B, 4xyj:C, 4xyj:D, 4xyj:E, 4xyj:F, 4xyj:G, 4xyj:H, 4xyk:A, 4xyk:B, 4xyk:C, 4xyk:D, 4xz2:A, 4xz2:B, 4xz2:C, 4xz2:D

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218