BioLiP

>protein
QLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIR
EFLEEI

The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3kik:A	94	86	1.0000	0.9149	1.0000	1.36e-57	4c31:B, 4c31:E, 3kik:B, 3kik:D, 3kik:C, 3kjl:A, 3kjl:B, 3kjl:C, 3kjl:D, 4mbe:F, 4mbe:C
2	2a81:A	235	37	0.1395	0.0511	0.3243	1.1
3	5e3x:A	489	32	0.1395	0.0245	0.3750	3.8
4	8v83:b	423	33	0.1395	0.0284	0.3636	4.7	6elz:b, 6em1:b, 6em5:b, 7ohp:b, 7ohr:b, 7ohs:b, 7ohu:b, 7ohv:b, 8v84:b
5	7ohy:b	375	33	0.1395	0.0320	0.3636	5.4
6	4b7f:A	515	42	0.1279	0.0214	0.2619	5.8	4b7f:B, 4b7f:C, 4b7f:D, 4b7g:A, 4b7g:B, 4b7g:C, 4b7g:D, 4b7h:A, 4b7h:B, 4b7h:C, 4b7h:D
7	6ylg:b	613	33	0.1395	0.0196	0.3636	6.4	7nac:b, 7of1:b, 7r7a:b, 6ylh:b
8	5j6f:A	352	32	0.1163	0.0284	0.3125	6.8	5j6f:B
9	8hfr:rA	647	33	0.1395	0.0185	0.3636	6.9	7bt6:b, 7btb:b, 6c0f:W, 6ft6:b, 3jct:b, 5jcs:o, 6m62:b, 6n8j:b, 6n8k:b, 7nad:b, 7oh3:b, 7ohq:b, 7oht:b, 7r72:b, 7u0h:b, 7ug6:b, 7uoo:b, 7uqb:b, 7uqz:b, 7v08:b, 4v7f:o, 8v87:b, 6ylx:b, 6yly:b, 7z34:b
10	7mqa:LO	819	50	0.1628	0.0171	0.2800	7.0
11	7mq8:LO	848	50	0.1628	0.0165	0.2800	7.0	7mq9:LO
12	6j72:A	561	48	0.1279	0.0196	0.2292	7.4
13	3ce2:A	595	21	0.1163	0.0168	0.4762	8.8
14	7ohw:b	259	27	0.1279	0.0425	0.4074	9.4
15	4y9v:A	603	57	0.1628	0.0232	0.2456	10.0

[Back]