QLKLEQKIKMKMAKKIRLRRTGLCAKESLRKRGAWPPSKMKKLKNV
The query sequence (length=46) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5mlc:7 | 46 | 46 | 1.0000 | 1.0000 | 1.0000 | 4.19e-26 | |
2 | 6eri:Aw | 49 | 46 | 0.8696 | 0.8163 | 0.8696 | 4.33e-12 | 5mmi:6, 5mmm:6, 5x8p:6, 5x8t:6 |
3 | 5h1s:g | 43 | 25 | 0.5435 | 0.5814 | 1.0000 | 0.006 | |
4 | 7vtq:A | 789 | 38 | 0.2174 | 0.0127 | 0.2632 | 3.2 | 7vtq:B, 7vtq:C, 7vtq:D, 7vtq:E, 7vtq:F, 7vtq:G, 7vtq:H, 7vtq:I, 7vtq:J, 7vtq:K, 7vtq:L |
5 | 6bli:D | 221 | 16 | 0.1304 | 0.0271 | 0.3750 | 3.9 | 6bli:G, 6bli:J |
6 | 4rxl:A | 229 | 27 | 0.2174 | 0.0437 | 0.3704 | 4.5 | |
7 | 1amf:A | 231 | 14 | 0.1957 | 0.0390 | 0.6429 | 6.4 | 3axf:A, 3axf:B, 3axf:C, 3r26:A, 1wod:A, 4xxu:A, 4xxu:B |
8 | 8k8l:A | 231 | 14 | 0.1957 | 0.0390 | 0.6429 | 7.0 | |
9 | 2y6p:B | 233 | 21 | 0.1957 | 0.0386 | 0.4286 | 8.7 | 2y6p:A, 2y6p:C |