QLDQEILLDAGAQLHRLKMYPYFDVAHYLLMIIEVRDDLGSAASIFSRKHPLSCWLSSMLMCFADAFLANFLLGEPVIAP
FKRHDDIILATIIWYLVFYAPFDGIYKIAKITPVKCVLAVMKEVKRAYKVSHGVSHAAKLYPNSYIVQVLVGTAKGAGSG
IVRTLEQLVRGVWLPTHNELLRPSFATKACVVAASVLALEKSGTYLTAPHDLVYLVIVGFFVYFKLSAVILH
The query sequence (length=232) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5egi:B | 233 | 230 | 0.9914 | 0.9871 | 1.0000 | 1.08e-170 | 5egi:A, 5egi:C |
2 | 5eik:A | 234 | 230 | 0.5905 | 0.5855 | 0.5957 | 1.59e-106 | |
3 | 6izf:A | 224 | 207 | 0.3103 | 0.3214 | 0.3478 | 5.67e-41 | |
4 | 2dcu:A | 407 | 64 | 0.0819 | 0.0467 | 0.2969 | 0.27 | 2d74:A, 1kjz:A, 1kk0:A, 1kk1:A, 1kk2:A, 1kk3:A |
5 | 6wq2:A | 154 | 35 | 0.0560 | 0.0844 | 0.3714 | 8.0 | 6wq2:B, 6wq2:C, 6wq2:D, 6wq2:E, 6wq2:F, 6wq2:G, 6wq2:H, 6wq2:I, 6wq2:J, 6wq2:K, 6wq2:L, 6wq2:M, 6wq2:N, 6wq2:P, 6wq2:R, 6wq2:T |