BioLiP

>protein
QKYLFIDRDGTLISEPPSDFQVDRFDKLAFEPGVIPQLLKLQKAGYKLVMITNQDGLGTQSFPQADFDGPHNLMMQIFTS
QGVQFDEVLICPHLPADECDCRKPKVKLVERYLAMDRANSYVIGDRATDIQLAENMGINGLRYDRETLNWPMIGEQLTRR

The query sequence (length=160) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2fps:B	163	163	1.0000	0.9816	0.9816	1.68e-117	2fpr:A, 2fpr:B, 2fps:A, 2fpu:A, 2fpu:B, 2fpw:A, 2fpw:B, 2fpx:A, 2fpx:B
2	3l8e:A	185	150	0.3187	0.2757	0.3400	4.10e-21	3esq:A, 3esr:A, 2gmw:A, 2gmw:B, 3l1u:A, 3l1u:B, 3l1v:A, 3l1v:B, 3l8e:B, 3l8f:A, 3l8g:A
3	3l8h:A	179	139	0.2750	0.2458	0.3165	2.08e-17	3l8h:B, 3l8h:C, 3l8h:D
4	3u7e:B	380	90	0.1750	0.0737	0.3111	1.15e-04	3u7f:B, 3u7g:A, 3u7h:B, 3zvl:A, 3zvm:A, 3zvm:B, 3zvn:A
5	2go7:C	205	51	0.1062	0.0829	0.3333	0.022	2go7:A, 2go7:B, 2go7:D
6	2yn4:A	225	31	0.0813	0.0578	0.4194	0.34	2yn4:B
7	7nkl:d	327	49	0.1062	0.0520	0.3469	0.41
8	4ygr:A	215	124	0.1812	0.1349	0.2339	0.80	4ygs:A
9	5yei:C	397	77	0.1125	0.0453	0.2338	3.5	5yei:D, 5yei:B, 5yei:A, 5yei:F, 5yei:E, 5yei:H, 5yei:G
10	9bh5:CZ	135	40	0.0813	0.0963	0.3250	5.0	9cai:CZ
11	4ex6:A	219	115	0.1875	0.1370	0.2609	5.4	4ex7:A
12	7p01:A	572	45	0.0813	0.0227	0.2889	6.1	7p01:B, 7p07:A, 7p07:B
13	2x5f:A	428	84	0.1375	0.0514	0.2619	6.8	2x5f:B
14	5kis:A	1446	55	0.1187	0.0131	0.3455	8.9
15	6fxh:A	481	50	0.1000	0.0333	0.3200	9.8	5cqz:A, 5cqz:B, 5cr7:A, 5cr7:B, 6ddb:A, 6ddb:B, 6ddc:A, 6ddc:B, 6ddh:A, 6ddz:A, 6de2:A, 6de3:A, 6fir:A, 6fis:A, 6fiu:A, 6fiw:A, 4h4b:A, 2j2c:A, 2jc9:A, 2jcm:A, 5opk:A, 5opl:A, 5opm:A, 5opo:A, 2xcv:A, 2xcw:A, 2xjb:A, 2xjc:A, 2xjd:A, 2xje:A, 2xjf:A

[Back]