QKYLFIDRDGTLISEPPSDFQVDRFDKLAFEPGVIPQLLKLQKAGYKLVMITNQDGLGTQSFPQADFDGPHNLMMQIFTS
QGVQFDEVLICPHLPADECDCRKPKVKLVERYLAEQAMDRANSYVIGDRATDIQLAENMGINGLRYDRETLNWPMIGEQL
TRR
The query sequence (length=163) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2fps:B | 163 | 163 | 1.0000 | 1.0000 | 1.0000 | 6.37e-122 | 2fpr:A, 2fpr:B, 2fps:A, 2fpu:A, 2fpu:B, 2fpw:A, 2fpw:B, 2fpx:A, 2fpx:B |
2 | 3l8e:A | 185 | 150 | 0.3006 | 0.2649 | 0.3267 | 7.37e-20 | 3esq:A, 3esr:A, 2gmw:A, 2gmw:B, 3l1u:A, 3l1u:B, 3l1v:A, 3l1v:B, 3l8e:B, 3l8f:A, 3l8g:A |
3 | 3l8h:A | 179 | 139 | 0.2638 | 0.2402 | 0.3094 | 3.14e-17 | 3l8h:B, 3l8h:C, 3l8h:D |
4 | 3u7e:B | 380 | 132 | 0.2454 | 0.1053 | 0.3030 | 2.64e-05 | 3u7f:B, 3u7g:A, 3u7h:B, 3zvl:A, 3zvm:A, 3zvm:B, 3zvn:A |
5 | 8pno:A | 202 | 117 | 0.1534 | 0.1238 | 0.2137 | 8.37e-04 | 2b0c:A, 8pne:A, 8pno:B |
6 | 2go7:C | 205 | 50 | 0.0982 | 0.0780 | 0.3200 | 0.005 | 2go7:A, 2go7:B, 2go7:D |
7 | 7nkl:d | 327 | 51 | 0.1043 | 0.0520 | 0.3333 | 0.24 | |
8 | 2yn4:A | 225 | 31 | 0.0798 | 0.0578 | 0.4194 | 0.34 | 2yn4:B |
9 | 4ygr:A | 215 | 123 | 0.1595 | 0.1209 | 0.2114 | 0.56 | 4ygs:A |
10 | 4pbg:A | 468 | 34 | 0.0859 | 0.0299 | 0.4118 | 3.5 | 4pbg:B |
11 | 5yei:C | 397 | 77 | 0.1104 | 0.0453 | 0.2338 | 3.6 | 5yei:D, 5yei:B, 5yei:A, 5yei:F, 5yei:E, 5yei:H, 5yei:G |
12 | 9bh5:CZ | 135 | 103 | 0.1472 | 0.1778 | 0.2330 | 3.8 | 9cai:CZ |
13 | 7p01:A | 572 | 45 | 0.0798 | 0.0227 | 0.2889 | 6.0 | 7p01:B, 7p07:A, 7p07:B |
14 | 5kis:A | 1446 | 55 | 0.1166 | 0.0131 | 0.3455 | 9.3 | |
15 | 6fxh:A | 481 | 50 | 0.0982 | 0.0333 | 0.3200 | 9.9 | 5cqz:A, 5cqz:B, 5cr7:A, 5cr7:B, 6ddb:A, 6ddb:B, 6ddc:A, 6ddc:B, 6ddh:A, 6ddz:A, 6de2:A, 6de3:A, 6fir:A, 6fis:A, 6fiu:A, 6fiw:A, 4h4b:A, 2j2c:A, 2jc9:A, 2jcm:A, 5opk:A, 5opl:A, 5opm:A, 5opo:A, 2xcv:A, 2xcw:A, 2xjb:A, 2xjc:A, 2xjd:A, 2xje:A, 2xjf:A |