QKASVSGPNSPSETRRERAFDANTMTSAEKVLCQFCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEP
The query sequence (length=78) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2ffw:A | 78 | 78 | 1.0000 | 1.0000 | 1.0000 | 7.64e-55 | |
2 | 2jun:A | 101 | 51 | 0.6538 | 0.5050 | 1.0000 | 1.44e-33 | 2dq5:A |
3 | 1szb:A | 167 | 60 | 0.2179 | 0.1018 | 0.2833 | 0.87 | 1szb:B |
4 | 8h8e:D | 293 | 20 | 0.1282 | 0.0341 | 0.5000 | 1.5 | 8h8e:B, 8h8e:C, 8h8e:E, 8h8e:F |
5 | 2h59:A | 246 | 41 | 0.1410 | 0.0447 | 0.2683 | 2.2 | 4buz:A, 4bv2:A, 4bv2:B, 3d4b:A, 3d81:A, 2h2d:A, 2h2f:A, 2h2g:A, 2h2h:A, 2h2i:A, 2h4f:A, 2h4h:A, 2h4j:A, 2h59:B, 3jr3:A, 3pdh:A, 1yc5:A |
6 | 3v0h:B | 327 | 31 | 0.1667 | 0.0398 | 0.4194 | 3.8 | 3v0h:A |
7 | 2yur:A | 74 | 33 | 0.1795 | 0.1892 | 0.4242 | 4.7 | |
8 | 3ztg:A | 92 | 33 | 0.1795 | 0.1522 | 0.4242 | 7.3 | 3ztg:B |
9 | 8btd:LL | 168 | 20 | 0.1154 | 0.0536 | 0.4500 | 7.5 | 8br8:LL, 8brm:LL, 8bsi:LL, 8bsj:LL, 8btr:LL, 8fru:J, 7pwg:J, 7pwo:J2 |
10 | 8q7i:A | 257 | 53 | 0.1923 | 0.0584 | 0.2830 | 9.4 | 7o1f:A, 7o1f:B, 7o1f:D, 7o1f:F, 8p9o:A |
11 | 5usf:A | 682 | 36 | 0.1410 | 0.0161 | 0.3056 | 9.7 | 3p0h:A, 3p0i:A, 3p0j:C, 3p0j:D, 5usf:B |