QKAINNFLWKKVVPPLVALGIFLVIWQLLCLNPNFKLPGPIETFSETWDPFIINPFFDNGESDKGLGWQILSSLGRVGLG
FSLAAIAGIILGILIGVNPLVYNAVDPIFQVLRTVPPLAWLPISLAAFQQANPSAIFVIFITSIWPILLNTTVGVQQIPQ
DYINVAKVLRLKGVKYFFKIVFPATVPYIFTGLRIGIGLSWLAIVAAEMLVGGVGIGSFIWDAYNTTTETNLSEIILALI
YVGLVGLLLDRLVGFVASKVVAD
The query sequence (length=263) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8wm8:B | 265 | 263 | 1.0000 | 0.9925 | 1.0000 | 0.0 | 8wm8:A |
2 | 3na1:A | 472 | 177 | 0.1445 | 0.0805 | 0.2147 | 0.26 | 3n9y:A, 3n9y:B, 3n9z:A, 3n9z:B, 3na0:A, 3na0:B, 3na1:B |
3 | 7l6c:B | 268 | 80 | 0.0760 | 0.0746 | 0.2500 | 3.0 | 7l6c:A, 7l6c:C, 7l6c:D, 7u0m:A, 7u0m:B |
4 | 6klg:A | 547 | 59 | 0.0684 | 0.0329 | 0.3051 | 3.9 | 6kli:A, 6klj:A |
5 | 2qdg:A | 366 | 38 | 0.0494 | 0.0355 | 0.3421 | 6.2 | 2qap:A, 2qap:B, 2qap:C, 2qap:D, 2qdg:B, 2qdg:C, 2qdg:D, 2qdh:A, 2qdh:B, 2qdh:C, 2qdh:D |
6 | 1f3t:B | 381 | 75 | 0.0837 | 0.0577 | 0.2933 | 6.8 | 1f3t:A, 1f3t:C, 1f3t:D, 1njj:A, 1njj:B, 1njj:C, 1njj:D, 1qu4:A, 1qu4:B, 1qu4:C, 1qu4:D, 1szr:C, 1szr:D, 1szr:A, 1szr:B, 2tod:A, 2tod:B, 2tod:C, 2tod:D |
7 | 2o56:A | 392 | 63 | 0.0684 | 0.0459 | 0.2857 | 6.9 | 2o56:B, 2o56:C, 2o56:D, 2o56:E, 2o56:F, 2o56:G, 2o56:H |
8 | 2paa:A | 413 | 115 | 0.1027 | 0.0654 | 0.2348 | 8.3 |