QIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLN
VQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDW
KKDKCEPLEKQHEKE
The query sequence (length=175) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3kq0:A | 175 | 175 | 1.0000 | 1.0000 | 1.0000 | 2.52e-132 | |
2 | 3apx:A | 179 | 175 | 0.8857 | 0.8659 | 0.8857 | 3.04e-118 | 3apv:A, 3apv:B, 3apw:A, 3apw:B, 7oub:B |
3 | 4gah:B | 195 | 55 | 0.0800 | 0.0718 | 0.2545 | 1.9 | 4gah:A |
4 | 6ray:3 | 600 | 50 | 0.1029 | 0.0300 | 0.3600 | 2.4 | 6raw:3, 6raz:3 |
5 | 6rax:3 | 625 | 50 | 0.1029 | 0.0288 | 0.3600 | 2.5 | |
6 | 2atz:A | 176 | 50 | 0.0857 | 0.0852 | 0.3000 | 6.7 |