QIANVVLADGQAAPADKTFEPQRGQNGVTDPAEWWEKSSPTLNGYRRLTALVRRNAASKSVKVKVAIYDPTLAVTAPSTA
SGIQPSPTVAFTCPVFIEFTLPDACTIQNRKDILAYAKNFLASATATDLVVNTAPQY
The query sequence (length=137) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6yfk:AO | 137 | 137 | 1.0000 | 1.0000 | 1.0000 | 1.76e-98 | 6yfk:BG, 6yfk:AU, 6yfk:AC |
2 | 4ang:A | 131 | 143 | 0.2701 | 0.2824 | 0.2587 | 8.28e-04 | 4ang:B, 4ang:C |
3 | 8tux:ab | 127 | 106 | 0.2336 | 0.2520 | 0.3019 | 0.002 | 2qux:A, 2qux:B, 2qux:E, 2qux:D, 2qux:G, 2qux:H, 2qux:J, 2qux:K, 2qux:M, 2qux:N, 2qux:P, 2qux:Q |
4 | 5kr6:B | 460 | 46 | 0.1095 | 0.0326 | 0.3261 | 1.1 | 5kr6:A |
5 | 3h9e:P | 337 | 31 | 0.1022 | 0.0415 | 0.4516 | 4.0 | 5c7o:O, 5c7o:P, 3h9e:O, 3pfw:O, 3pfw:P |
6 | 1jdl:A | 118 | 22 | 0.0876 | 0.1017 | 0.5455 | 4.8 | |
7 | 6llz:A | 436 | 53 | 0.1241 | 0.0390 | 0.3208 | 7.6 | 7cyw:A, 6llw:A, 6llw:B, 6llz:B |