QGLEYQFEVQGQSEYVDTNFTGTAQGTYYFKNVDASKGPLAEAAFLNQASNVSVAYNYIKYESHTYGVKGEAYLPTPYLP
VYASASYNHTIGDRYALEAGAMLLPNFLVAVGYTSVDAVTARTKYVGNIDGTNMAIGFEAFGVFAEDNAYGMKTDLFVTP
KLSVGASFADVSAFNSGYDHVWGGHTQYFITPAVAVGADFVKANADTQTIGLNAKFRF
The query sequence (length=218) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6gie:A | 218 | 218 | 1.0000 | 1.0000 | 1.0000 | 1.89e-160 | |
2 | 5k8k:A | 237 | 89 | 0.1055 | 0.0970 | 0.2584 | 0.31 | |
3 | 8csp:5 | 319 | 56 | 0.0780 | 0.0533 | 0.3036 | 1.3 | 6aax:A, 6aax:C, 6ajk:A, 8csq:5, 8csr:5, 8csu:5 |
4 | 8h1c:B | 983 | 110 | 0.1376 | 0.0305 | 0.2727 | 1.5 | 8h1c:A, 7xjz:A, 7xk0:A, 7xk1:A, 7xk1:C |
5 | 9asp:B | 250 | 89 | 0.1055 | 0.0920 | 0.2584 | 2.7 | 9asm:B, 9asn:B, 9asq:B |
6 | 4v58:G | 2060 | 59 | 0.0917 | 0.0097 | 0.3390 | 2.9 | 4v58:H, 4v58:I, 4v58:J, 4v58:K, 4v58:L, 4v59:G, 4v59:H, 4v59:I, 4v59:J, 4v59:K, 4v59:L |
7 | 5tx1:N | 473 | 50 | 0.0780 | 0.0359 | 0.3400 | 7.7 | 7tau:N |