QGENISSLLRELYAKPLSERHVESDGLIFDPAQITSRTANGVAVPHGDHYHFIPYSQLSPLEEKLARIIPL
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6csl:A | 71 | 71 | 1.0000 | 1.0000 | 1.0000 | 6.72e-48 | |
2 | 2cs7:A | 55 | 35 | 0.2394 | 0.3091 | 0.4857 | 1.64e-07 | 2cs7:B, 2cs7:C |
3 | 7zc6:C | 435 | 35 | 0.1972 | 0.0322 | 0.4000 | 0.92 | |
4 | 1kfq:A | 571 | 30 | 0.1831 | 0.0228 | 0.4333 | 1.5 | 1kfi:A, 1kfi:B, 1kfq:B |
5 | 3zfj:A | 119 | 25 | 0.1408 | 0.0840 | 0.4000 | 1.8 | |
6 | 5a22:A | 2002 | 33 | 0.2113 | 0.0075 | 0.4545 | 2.4 | |
7 | 6u1x:A | 2059 | 33 | 0.2113 | 0.0073 | 0.4545 | 2.5 | |
8 | 9f7k:A | 222 | 30 | 0.1690 | 0.0541 | 0.4000 | 3.5 | 9f7k:B |
9 | 8d2k:A | 1105 | 27 | 0.1549 | 0.0100 | 0.4074 | 5.8 | 8d2l:A, 8d2n:A, 8d2p:A |
10 | 6wbr:A | 942 | 27 | 0.1549 | 0.0117 | 0.4074 | 6.3 | 6wc0:A |
11 | 3eei:A | 231 | 24 | 0.1408 | 0.0433 | 0.4167 | 6.3 | 3eei:B |
12 | 2y5s:B | 281 | 12 | 0.1268 | 0.0320 | 0.7500 | 8.2 | 2y5s:A |
13 | 7lgb:A | 282 | 25 | 0.1268 | 0.0319 | 0.3600 | 8.6 |