QEVRPEDLGTGLLEALLRGDLAGAEALFRRGLRFWGPEGVLEHLLLPVLREVGEAWHRGEIGVAEEHLASTFLRARLQEL
LDLAGFPPGPPVLVTTPPGERHEIGAMLAAYHLRRKGVPALYLGPDTPLPDLRALARRLGAGAVVLSAVLSEPLRALPDG
ALKDLAPRVFLGGQGAGPEEARRLGAEYMEDLKGLAEALWLPRGP
The query sequence (length=205) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5c8d:E | 280 | 205 | 1.0000 | 0.7321 | 1.0000 | 7.03e-138 | 8c31:A, 8c31:B, 8c31:C, 8c31:D, 8c32:A, 8c32:B, 8c32:C, 8c32:D, 8c33:A, 8c33:B, 8c33:C, 8c33:D, 8c34:A, 8c34:B, 8c34:C, 8c34:D, 8c35:A, 8c35:B, 8c35:C, 8c35:D, 8c36:A, 8c36:B, 8c36:C, 8c36:D, 8c37:A, 8c37:B, 8c37:C, 8c37:D, 8c73:A, 8c73:B, 8c73:C, 8c73:D, 8c76:A, 8c76:B, 8c76:C, 8c76:D, 5c8a:A, 5c8a:B, 5c8a:C, 5c8a:D, 5c8d:A, 5c8d:B, 5c8d:C, 5c8d:D, 5c8d:F, 5c8d:G, 5c8d:H, 5c8e:A, 5c8e:B, 5c8e:C, 5c8e:E, 5c8e:F, 5c8e:G, 5c8e:D, 5c8e:H, 5c8f:A, 3whp:A |
2 | 7te2:A | 205 | 71 | 0.1512 | 0.1512 | 0.4366 | 3.71e-10 | |
3 | 8j2y:A | 327 | 154 | 0.2390 | 0.1498 | 0.3182 | 4.37e-07 | 8j2y:B |
4 | 8j2x:A | 337 | 184 | 0.2878 | 0.1751 | 0.3207 | 3.01e-04 | 8j2w:A, 8j2w:B |
5 | 4jgi:B | 206 | 147 | 0.1756 | 0.1748 | 0.2449 | 0.007 | 4jgi:A |
6 | 4z17:A | 424 | 98 | 0.1610 | 0.0778 | 0.3367 | 0.074 | 4yws:A, 4z17:B, 4z1y:A, 4z1y:B |
7 | 3c9h:B | 339 | 64 | 0.0927 | 0.0560 | 0.2969 | 0.53 | 3c9h:A |
8 | 7xcn:P | 215 | 104 | 0.1171 | 0.1116 | 0.2308 | 0.69 | 7xcn:M, 7xcn:N, 7xcn:O, 7xcn:Q, 7xcn:R |
9 | 2fge:A | 979 | 77 | 0.1171 | 0.0245 | 0.3117 | 2.9 | 2fge:B |
10 | 8swu:A | 269 | 35 | 0.0780 | 0.0595 | 0.4571 | 3.3 | 8swu:B, 8swu:C |
11 | 7acs:A | 140 | 75 | 0.1122 | 0.1643 | 0.3067 | 4.8 | 7act:A, 8iv3:D, 8j6x:A, 8j6x:D, 6vyo:A, 6vyo:B, 6vyo:C, 6vyo:D, 6wkp:B, 6wkp:C, 6wkp:D, 7xwz:A, 7xwz:B, 7xx1:A, 7xx1:B, 7xx1:C, 7xx1:D |
12 | 5af7:B | 391 | 131 | 0.1415 | 0.0742 | 0.2214 | 5.6 | 5af7:A, 5ahs:A, 5ahs:B, 5ahs:C, 5ahs:E, 5ahs:F, 5ahs:D |
13 | 8ppg:B | 243 | 41 | 0.0732 | 0.0617 | 0.3659 | 8.1 |