QDWPRRVKTNKGREFMFPTDLLHRTPPQVLLDALVNEYESPLSATELSDDWPEMTFEERKNVAFNL
The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8p0y:A | 66 | 66 | 1.0000 | 1.0000 | 1.0000 | 8.30e-45 | 8p10:L |
2 | 4c4a:A | 641 | 63 | 0.3333 | 0.0343 | 0.3492 | 0.25 | 6ogn:A |
3 | 1p4e:B | 413 | 37 | 0.1970 | 0.0315 | 0.3514 | 0.36 | 1flo:A, 1flo:D, 1flo:B, 1flo:C, 1m6x:A, 1m6x:C, 1m6x:D, 1m6x:B, 1p4e:A, 1p4e:C, 1p4e:D |
4 | 6zu5:SF0 | 186 | 22 | 0.1667 | 0.0591 | 0.5000 | 1.6 | |
5 | 8ow7:A | 277 | 28 | 0.1515 | 0.0361 | 0.3571 | 1.7 | 8ow7:B, 8ow7:C, 8ow7:D, 8ow7:E, 8ow7:F |
6 | 8dvm:A | 612 | 26 | 0.1515 | 0.0163 | 0.3846 | 3.0 | 4a0p:A, 8dvl:A, 8dvn:A |
7 | 4jo0:A | 522 | 50 | 0.2424 | 0.0307 | 0.3200 | 3.5 | 5kik:A, 5kil:A |
8 | 1gdt:A | 183 | 41 | 0.1515 | 0.0546 | 0.2439 | 6.2 | 1gdt:B, 2gm4:A, 2gm4:B, 1zr2:A, 1zr2:B, 1zr4:A, 1zr4:B, 1zr4:E, 1zr4:D |
9 | 1jft:A | 340 | 26 | 0.1818 | 0.0353 | 0.4615 | 6.9 | 1bdh:A, 1bdi:A, 1jfs:A, 1jh9:A, 1pnr:A, 2pua:A, 2pub:A, 2puc:A, 2pud:A, 2pue:A, 2puf:A, 2pug:A, 1qp0:A, 1qp4:A, 1qp7:A, 1qpz:A, 1qqa:A, 1qqb:A, 1vpw:A, 1wet:A, 1zay:A |
10 | 5o2w:A | 248 | 25 | 0.1970 | 0.0524 | 0.5200 | 8.2 | 5o2x:A |
11 | 1qwg:A | 251 | 32 | 0.1818 | 0.0478 | 0.3750 | 9.4 |