QDWNGIPVPANPGNGMTWQLQDNVSDSFNYTSSEGNRPTAFTSKWKPSYINGWTGPGSTIFNAPQAWTNGSQLAIQAQPA
GNGKSYNGIITSKNKIQYPVYMEIKAKIMDQVLANAFWTLTDDETQSIDIMEGYGSDRGGTWFAQRMHLSHHTFIRNPFT
DYQPMGDATWYYNGGTPWRSAYHRYGCYWKDPFTLEYYIDGVKVRTVTRAEIDPNNHLGGTGLNQATNIIIDCENQTDWR
PAATQEELADDSKNIFWVDWIRVYKPVA
The query sequence (length=268) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1o4y:A | 270 | 268 | 0.9963 | 0.9889 | 0.9963 | 0.0 | 1urx:A |
2 | 4atf:C | 297 | 296 | 0.4590 | 0.4141 | 0.4155 | 9.05e-74 | 4atf:A, 4atf:B, 4atf:D |
3 | 6aii:A | 330 | 321 | 0.4590 | 0.3727 | 0.3832 | 1.45e-57 | |
4 | 7fgz:A | 260 | 272 | 0.3470 | 0.3577 | 0.3419 | 3.01e-50 | |
5 | 4asm:B | 357 | 355 | 0.4291 | 0.3221 | 0.3239 | 1.61e-45 | |
6 | 3ilf:A | 257 | 281 | 0.2687 | 0.2802 | 0.2562 | 1.26e-10 | 4ate:A |
7 | 6hy3:A | 269 | 280 | 0.2537 | 0.2528 | 0.2429 | 1.14e-07 | |
8 | 4awd:A | 297 | 92 | 0.1157 | 0.1044 | 0.3370 | 2.16e-06 | 4awd:B |
9 | 3atg:A | 242 | 206 | 0.2052 | 0.2273 | 0.2670 | 5.49e-05 | |
10 | 9int:A | 282 | 131 | 0.1269 | 0.1206 | 0.2595 | 0.009 | |
11 | 6nig:C | 549 | 111 | 0.0896 | 0.0437 | 0.2162 | 1.8 | 6nig:A, 6nig:B, 6nig:D, 2z7x:A |
12 | 3a79:A | 550 | 117 | 0.1007 | 0.0491 | 0.2308 | 2.0 | 3a7b:A, 3a7c:A, 2z81:A, 2z82:A |
13 | 3dgt:A | 278 | 90 | 0.1007 | 0.0971 | 0.3000 | 3.1 | |
14 | 4g9i:A | 766 | 50 | 0.0672 | 0.0235 | 0.3600 | 5.1 | 4g9i:B, 4g9i:C, 4g9i:D, 4g9i:E, 4g9i:F |
15 | 3vmp:A | 632 | 40 | 0.0560 | 0.0237 | 0.3750 | 5.1 | 3vmo:A |
16 | 7awt:G | 907 | 49 | 0.0597 | 0.0176 | 0.3265 | 6.7 | 7nyr:G, 7nyu:G, 7nyv:G, 7nz1:G, 7p61:G, 7p62:G, 7p63:G, 7p64:G, 7p69:G, 7p7c:G, 7p7e:G, 7p7j:G, 7p7k:G, 7p7l:G, 7p7m:G, 7z7r:G, 7z7s:G, 7z7t:G, 7z7v:G, 7z80:G, 7z83:G, 7z84:G, 7zc5:G, 7zci:G |