BioLiP

>protein
QDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVT
VRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG

The query sequence (length=123) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1joc:A	123	123	1.0000	1.0000	1.0000	1.15e-88	1hyi:A, 1hyj:A, 1joc:B
2	2yqm:A	89	68	0.2764	0.3820	0.5000	5.03e-18	2yw8:A
3	1vfy:A	67	55	0.2195	0.4030	0.4909	2.86e-13
4	3t7l:A	74	61	0.2033	0.3378	0.4098	2.09e-12
5	6w9n:A	78	64	0.2276	0.3590	0.4375	3.91e-12
6	1dvp:A	217	93	0.2846	0.1613	0.3763	1.35e-11
7	4avx:A	218	58	0.2033	0.1147	0.4310	5.84e-11	3zyq:A
8	1x4u:A	84	63	0.1789	0.2619	0.3492	3.29e-04
9	1wfk:A	88	36	0.0976	0.1364	0.3333	0.092
10	1y02:A	91	35	0.1057	0.1429	0.3714	0.14
11	4auq:B	57	24	0.0894	0.1930	0.4583	0.40	4auq:E
12	6lpf:B	1006	53	0.1057	0.0129	0.2453	0.82	6kid:A, 6kie:A, 6kqy:A, 6kr7:A, 6lpf:A, 6lr6:A, 6lr6:B
13	3v7p:A	409	66	0.1789	0.0538	0.3333	1.5	4m51:A
14	6ys4:B	102	47	0.1301	0.1569	0.3404	3.0	6ys4:C
15	7r3b:C	371	35	0.1057	0.0350	0.3714	3.4	7r3b:A, 7r3b:B, 7r3b:D, 7r3b:E, 7r3b:F, 7r3b:G, 7r3b:H
16	8cmb:B	194	78	0.1870	0.1186	0.2949	4.0	8cmh:B, 4fqx:B, 2fse:B, 2fse:D, 1fv1:B, 1fv1:E, 4gbx:B, 1h15:B, 1h15:E, 8pje:E, 4x5w:B, 7yx9:B, 1zgl:B, 1zgl:E
17	3wem:A	830	23	0.0894	0.0133	0.4783	5.5	3w37:A, 3wel:A, 3wen:A, 3weo:A
18	7ufg:B	1182	55	0.1220	0.0127	0.2727	7.0	8d8o:B
19	8ro0:W	496	38	0.0976	0.0242	0.3158	7.8	8ro1:W

[Back]