QCTLCKSKKHSKERCPSIWRAYILVHTIYCYNCGGKGHFGDDCKEKRSSRVPNEDGSAFTGSNL
The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3nyb:B | 64 | 64 | 1.0000 | 1.0000 | 1.0000 | 3.47e-44 | |
2 | 2lli:A | 124 | 59 | 0.7188 | 0.3710 | 0.7797 | 1.79e-25 | |
3 | 9fmd:U | 295 | 35 | 0.2188 | 0.0475 | 0.4000 | 0.061 | 8c6j:h, 6icz:Z, 6qdv:c, 7w5a:1, 7w5b:1, 5xjc:Z |
4 | 6rwg:A | 157 | 21 | 0.1406 | 0.0573 | 0.4286 | 0.18 | 1a1t:A, 1aaf:A, 1bj6:A, 2buo:A, 1esk:A, 2exf:A, 1f6u:A, 5i1r:A, 2jzw:A, 2l4l:A, 2m3z:A, 1mfs:A, 1q3y:A, 1q3z:A, 7r7p:I, 7r7p:L |
5 | 6rwg:A | 157 | 20 | 0.1250 | 0.0510 | 0.4000 | 9.3 | 1a1t:A, 1aaf:A, 1bj6:A, 2buo:A, 1esk:A, 2exf:A, 1f6u:A, 5i1r:A, 2jzw:A, 2l4l:A, 2m3z:A, 1mfs:A, 1q3y:A, 1q3z:A, 7r7p:I, 7r7p:L |
6 | 6wq6:A | 547 | 25 | 0.1406 | 0.0165 | 0.3600 | 0.73 | 6wqi:A, 6wqi:B, 6wqs:A, 6wqt:A |
7 | 6bk8:O | 229 | 19 | 0.1719 | 0.0480 | 0.5789 | 0.86 | |
8 | 2ec7:A | 49 | 21 | 0.1406 | 0.1837 | 0.4286 | 1.6 | |
9 | 2ihx:A | 50 | 20 | 0.1562 | 0.2000 | 0.5000 | 1.8 | |
10 | 7b9v:c | 37 | 18 | 0.1562 | 0.2703 | 0.5556 | 1.9 | |
11 | 8opp:A | 670 | 15 | 0.1250 | 0.0119 | 0.5333 | 2.2 | |
12 | 8opt:A | 783 | 15 | 0.1250 | 0.0102 | 0.5333 | 2.3 | 8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B |
13 | 3gzj:A | 254 | 21 | 0.1875 | 0.0472 | 0.5714 | 2.4 | 3gzj:B, 3gzj:C, 3gzj:D |
14 | 2bl6:A | 37 | 18 | 0.1250 | 0.2162 | 0.4444 | 3.1 | |
15 | 4ecg:A | 368 | 26 | 0.1719 | 0.0299 | 0.4231 | 3.3 | |
16 | 8xof:R | 265 | 23 | 0.1250 | 0.0302 | 0.3478 | 3.4 | |
17 | 2li8:A | 63 | 15 | 0.1406 | 0.1429 | 0.6000 | 3.4 | |
18 | 6d57:B | 151 | 54 | 0.2344 | 0.0993 | 0.2778 | 4.1 | 6d57:A, 4ets:A, 4ets:B |
19 | 6exn:c | 204 | 18 | 0.1562 | 0.0490 | 0.5556 | 4.1 | |
20 | 8bja:B | 1638 | 20 | 0.1562 | 0.0061 | 0.5000 | 4.6 | |
21 | 2w57:A | 131 | 37 | 0.1562 | 0.0763 | 0.2703 | 4.7 | 2w57:B |
22 | 8bja:A | 1563 | 20 | 0.1562 | 0.0064 | 0.5000 | 4.7 | |
23 | 2a51:A | 39 | 22 | 0.1250 | 0.2051 | 0.3636 | 4.8 | |
24 | 8p82:A | 1596 | 20 | 0.1562 | 0.0063 | 0.5000 | 4.8 | 8p82:B |
25 | 8d4x:B | 1669 | 20 | 0.1562 | 0.0060 | 0.5000 | 5.2 | 8c06:A, 8c06:D |
26 | 8e0q:A | 1689 | 20 | 0.1562 | 0.0059 | 0.5000 | 5.2 | 8d4x:A, 8e0q:B |
27 | 8ewi:A | 1775 | 20 | 0.1562 | 0.0056 | 0.5000 | 5.4 | 8ewi:B, 8ewi:C, 8ewi:D |
28 | 8j6w:A | 145 | 37 | 0.1719 | 0.0759 | 0.2973 | 5.5 | |
29 | 5udz:A | 139 | 15 | 0.1406 | 0.0647 | 0.6000 | 6.1 | 8ops:B, 8opt:B, 8ost:B, 3trz:A, 3trz:B, 3trz:C, 3trz:D, 3trz:E, 3trz:F, 3ts0:A, 3ts0:B, 3ts2:A, 3ts2:B, 5udz:B |
30 | 2cqf:A | 63 | 15 | 0.1406 | 0.1429 | 0.6000 | 6.2 | |
31 | 7s7b:F | 352 | 15 | 0.1094 | 0.0199 | 0.4667 | 7.1 | 7s7b:B, 7s7c:B |
32 | 1ee9:A | 317 | 23 | 0.1719 | 0.0347 | 0.4783 | 7.4 |