BioLiP

>protein
QCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLA

The query sequence (length=69) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7yrb:A	83	69	1.0000	0.8313	1.0000	1.59e-48	5vmd:A, 5vmd:C, 5vmd:B, 5vmd:D
2	8j9q:A	73	58	0.3188	0.3014	0.3793	4.98e-10	8j9q:B, 8j9q:C, 8j9r:A
3	8bja:B	1638	44	0.2174	0.0092	0.3409	1.11e-05
4	8d4x:B	1669	44	0.2174	0.0090	0.3409	1.25e-05	8c06:A, 8c06:D
5	8e0q:A	1689	44	0.2174	0.0089	0.3409	1.25e-05	8d4x:A, 8e0q:B
6	8ewi:A	1775	44	0.2174	0.0085	0.3409	1.25e-05	8ewi:B, 8ewi:C, 8ewi:D
7	8bja:A	1563	44	0.2174	0.0096	0.3409	1.26e-05
8	8p82:A	1596	44	0.2174	0.0094	0.3409	1.43e-05	8p82:B
9	7y70:A	77	49	0.2899	0.2597	0.4082	0.009	6lhn:A, 7xwd:A, 7xwe:A, 7xwe:B, 7xwf:A, 7xwg:A, 7xwg:B, 7y6w:A, 7y6x:A, 7y6x:B, 7y6x:D, 7y6x:E, 7y6x:F, 7y6x:G, 7y6x:H, 7y6x:C, 7y6y:A, 7y6y:B, 7y6y:C, 7y6y:D, 7y6z:A
10	7mex:A	1737	49	0.2609	0.0104	0.3673	0.012	6kgi:B, 7mey:A, 3nih:A, 3nii:A, 3nij:A, 3nik:B, 3nik:D, 3nik:A, 3nik:F, 3nil:D, 3nil:A, 3nil:B, 3nil:F, 3nim:B, 3nim:F, 3nim:A, 3nim:D, 3nin:A, 3nin:B, 3nis:A, 3nis:B, 3nis:D, 3nis:F, 3nit:A
11	7wul:A	70	45	0.2609	0.2571	0.4000	0.37	7wuk:A, 7wum:A, 7wun:A
12	6k15:H	393	56	0.2319	0.0407	0.2857	0.99	6kw4:H, 6kw5:H, 6v8o:I, 6v92:I
13	8btd:SC	210	47	0.1594	0.0524	0.2340	4.2	8br8:SC, 8brm:SC, 8bsi:SC, 8bsj:SC, 8btr:SC, 8fvy:D, 8g4s:D, 7pwf:D, 7pwo:D1
14	3gve:A	334	26	0.1449	0.0299	0.3846	7.5	3gve:B
15	8ibt:A	694	13	0.1014	0.0101	0.5385	7.7	8ibs:A, 8ibs:B, 8ibs:C, 8ibs:D, 8ibs:E, 8ibs:F, 8ibt:B

[Back]